KEGG   Bacillus velezensis NAU-B3: BAPNAU_1341
Entry
BAPNAU_1341       CDS       T02859                                 

Gene name
mmgB
Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00360  Phenylalanine metabolism
bamb00362  Benzoate degradation
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_1341 (mmgB)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BAPNAU_1341 (mmgB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAPNAU_1341 (mmgB)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     BAPNAU_1341 (mmgB)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 2-Hacid_dh_C NAD_binding_7 XdhC_C adh_short PALP DFP NAD_Gly3P_dh_N AlaDh_PNT_C F420_oxidored
Other DBs
NCBI-ProteinID: CDH95122
LinkDB
Position
1391371..1392267
AA seq 298 aa
MPSCWRCTDQRRERRMKMKTIMVAGAGQMGAGIAQTAAEAGFAVKLYDWEPETVTKGLHR
IKANLEKEQAKGRKSQQETDAAFSRISPAELREAGDADFVIEAIAENKKAKAELFDTLDK
ICPPHAVLASNTSSLPITELAAATKRPEKVIGMHFMNPVPVMELVEVIRGLATSEETAET
VKKLAVRMNKTPVEVNDFPGFISNRILMPMINEAVYCLYEGAASKEAIDEVMKLGMRHPM
GPLTLADFIGLDTCLSIMEVLYAGLGDPKYRPCPLLRKYVSAGWLGKKSGRGFYEYGR
NT seq 897 nt   +upstreamnt  +downstreamnt
atgccgtcctgctggaggtgtactgatcaaaggagggagcgccggatgaagatgaaaaca
atcatggtcgcaggtgccggtcagatgggagcaggcatcgctcagacggctgcagaagcc
gggtttgccgtcaagttatacgattgggagccggaaacggtaacaaaaggtcttcaccgc
ataaaggcaaacctggagaaagagcaggcaaaaggacggaagtcacagcaggagacagat
gccgctttcagccgtatttccccggcagaactcagagaagcgggagatgctgattttgta
attgaagccattgccgaaaacaaaaaagcaaaagcggaattgtttgacacactagataaa
atctgtcccccgcatgccgtattggcaagcaatacgtcttctcttcccattacggagctt
gccgcggccacaaaaaggcctgaaaaagtaatcggcatgcattttatgaatccggttcct
gtcatggagcttgtcgaagtcatcagaggactcgccacatcggaagaaacagcggaaaca
gtaaagaagcttgccgtccggatgaataaaacccctgtcgaagtcaatgacttcccgggc
tttatatctaatcgcatattaatgccgatgattaacgaagccgtttattgcctttacgaa
ggagcagcttcaaaggaagcgattgatgaggtgatgaagctcggcatgcggcatccgatg
ggtcctttaacattagctgacttcatcgggctggatacgtgcctttccattatggaggtt
ctctatgcggggctcggagatccgaaataccgcccatgccctctgctcagaaaatatgtc
agcgccggctggctcggcaaaaaaagcgggcgcggtttttatgagtacggcagatga

DBGET integrated database retrieval system