KEGG   Bacillus velezensis NAU-B3: BAPNAU_1348
Entry
BAPNAU_1348       CDS       T02859                                 

Gene name
ptb
Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_1348 (ptb)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     BAPNAU_1348 (ptb)
SSDB
Motif
Pfam: PTA_PTB
Other DBs
NCBI-ProteinID: CDH95129
LinkDB
Position
1399546..1400439
AA seq 297 aa
MKLRDLVEKAAAKNAKTIAVAHAADKEVIQAVKMAAEHLSARFLLTGDSGKLKELLANEP
KFNAEIIHADSPEESAAKAVRAVREQEADILMKGNLPSSTLLKSVLNRHEGLRSKRVLSH
VAVFEVPDYDRLMYVTDSALNIAPSLEELGHILQNAVHVAHSVGNPMPKAAVLAAIETVN
PKMEATLNAAAIVQMCNRGQITGCIADGPLALDNAVSQAAALQKGISGSVAGQADILLVP
SIEAGNMLYKSMIYFAKANVAAVIAGAKAPIALTSRADTAENKLYSIALAICASQEQ
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaagctgagagacctagttgaaaaagccgcggcaaaaaacgcaaaaaccattgcagtg
gcccacgcagcagataaagaagtgatccaggccgtcaaaatggcggcagaacacttgtcg
gcacgatttttactgacgggtgacagcggaaagctgaaagagcttctggcaaatgagccg
aagttcaatgctgaaatcatccacgccgattcacccgaagaatctgcggcaaaagcagtg
cgcgcagtgcgtgaacaagaggcggacattttaatgaaagggaatctcccgagctcaact
cttctgaaatcggttttaaaccgccatgaagggcttcgttcaaaaagggtgttatcacat
gtagccgtttttgaggtgccggactatgaccggctgatgtatgtgactgattcagcgctg
aacattgccccgtctcttgaagagctcgggcatattctgcaaaatgcggttcatgtcgca
cattcagtagggaaccctatgccgaaagccgcagtccttgccgctattgaaacggttaat
ccgaaaatggaggcgacgctgaacgcggctgcgatcgtccagatgtgcaacagaggacag
attaccggctgcattgcggacggaccgcttgctttggataatgccgtatcccaagcggct
gcgctgcaaaaagggatttccggaagcgtagcgggccaggcggatattctcttggttcct
tcaatcgaggccggaaatatgctttataagtcaatgatttattttgcgaaagcaaatgtt
gctgccgtcatcgccggtgcaaaagcgccgatcgcattaacgagcagagcggataccgca
gaaaataaactgtattcaattgcgcttgcgatttgcgcatcacaagaacagtag

DBGET integrated database retrieval system