KEGG   Bacillus velezensis NAU-B3: BAPNAU_1676
Entry
BAPNAU_1676       CDS       T02859                                 
Name
(GenBank) hypothetical protein
Organism
bamb  Bacillus velezensis NAU-B3
SSDB
Motif
Pfam: DUF4371
Other DBs
NCBI-ProteinID: CDH95457
LinkDB
Position
1763876..1764070
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WSKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaaggattttataaagatcagaagcttcaccttttagaagatcctatgcagcaa
tacactgtcatgaaagtagaagaaaatgctgtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagatttacagatgttgaagaggctaaaaagctccttggagagggc
tggtcaaaacaataa

DBGET integrated database retrieval system