KEGG   Bacillus velezensis NAU-B3: BAPNAU_1833
Entry
BAPNAU_1833       CDS       T02859                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_1833 (sucA)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BAPNAU_1833 (sucA)
SSDB
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Other DBs
NCBI-ProteinID: CDH95614
LinkDB
Position
1890252..1893086
AA seq 944 aa
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASG
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDPKKSELFPLSEYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEKAQNIETAVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCAASFTVHN
SPLSEGSVLGFEYGYNVYSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHAYEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDTKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLT
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgtttcaaaataatatgaaacaaagaatgaattgggaagatttttacggaccgaacctc
ggctacgcactggagctgtacgaccaatatgctgaagatccagacagcattgatccggat
ctgaaagacatgtttgacgaactcggcgctccgccaagccaaataaaagaggcatcggga
acaaaggaacagggacgcgtcaccgcagatctgattcaaaagatcgcagcagcagttaaa
cttgcagaagatattcgaacctatggccatctgaacgcttccgtcaatccgctcagaaag
gatccgaaaaagagcgagctctttccgttatccgagtacgggcttacagaagaagaaatg
aaagcaatacccgcgtctgtcatctgtaaagacgcacctgccaatataacaaacggctta
gaagccatccagcatttacgcaatacctataaaagaaccatctccttcgagtttgaccat
gtgcatgatttcgaagagcgcgcatggattacaaaaatggtcgaatccggagaactgttc
cggaaaaattcaccggaaaaactgtcagccgttttagaaagactgacggaagtagaagga
tttgaacaatttttacaccggacattcgtcggtcagaagcgtttctcaattgagggatta
gacgcgcttgtgccggttcttgacgacattatcgcccagtctgtgaaagcgggcacaacc
aatgtcaatatcgggatggcgcacagaggccgtttaaatgtgcttgcgcatgtgctcggc
aaaccgtatgagattattttctcggaattccagcacgcgccgaataaagaccttgtgccg
tctgaaggatcgaccggcatcagctacggctggacgggcgatgtaaaatatcacctcggt
gcagacagacagcttcaggatgctgaaaccaaaagcgcgcggattacgcttgcaaataac
ccgagccacttggaattcatcaatccgattgtggaaggaagcacgcgggcggcacaggaa
acaagaacgcaaaaggggtacccggttcaagacgaaacaaaatcgctcgccattttaatt
cacggtgacgcagcgtttccgggagaaggcattgtcgccgagacgctgaacttaagctct
ctgaaaggctatcaggtcggcggggccattcatatcatcgccaataatatgatcggcttt
acaacagaaagcgatgaatcacggtccacgaaatatgccagtgatttggcgaagggctac
gaaatcccgatcgttcacgtcaacgcggatgatccggaagcatgcctgtcagccgttaaa
tttgcggttgaataccggaagcggttcaataaagatttcttaatcgatttaatcgggtac
agacggtacggccacaatgaaatggatgagccgtcaacgacacagccgatgctgtatgac
gccgtcagaaaacacccgactgtcaagcggatctttgcggaaaaactcgtaagtgaagga
ctgatcagcgaggaaaaagcgcaaaacatcgaaacggcagtgacaaaacgtattgaagac
gcctataaaaaggtgcccgccaaaaaagaagacgccgtacgggaaattgaattgccggaa
ccggtgtccaacggttttccagacgttgacacagccattgattttgatgttctccgcaag
ctgaacggcgaacttatcaactggccggaatcttttaacgtgttcggcaagctgaaaaga
atcctggaaagacgtgcaaaagcgtttgatgatgaccgtaaagttgaatggtcattggct
gaatcgcttgcgtttgcttccattttgaaagacggcacgccgatccggctgaccggacag
gattcagagcgcggaacgttcgctcaaagaaaccttgtgctgcatgacagcgaaacagga
gaagaatttgttgccctccatcacttagacgactgcgctgcttcatttacggtgcataac
agcccgctctctgaaggatcggttctcggctttgaatatggatacaacgtgtattcgcct
gaaacgcttgtgatgtgggaggcgcagtacggggactttgccaatgcggctcaagtctat
tttgatcaatttatatctgcaggacgggcaaaatggggacaaaaatcaggcctggtcatg
ctgctgcctcacggttacgaagggcagggccctgaacactccagcggccgcgtcgagcgg
ttcctgcagctggcggcggaaaacaactggacggtggccaacctgacaagtgcggctcag
tatttccacattttaagaagacaagcgaaaatgctgcttcgtgaggaaatccgcccgctt
gtgatcatgacgccaaagagcctgctgcgtaacccgaatacggtatctgaagtgcaggaa
ctgagcgaaagccgattcaagcctgtctatgagcagtccggactttcccatgcttacgaa
aaagtgactcgcgtcgtattatcaagcggaaaagtgtcaattgatatcagcgatcacttc
aacaaaatggaaggcgataaggattggcttcatattgccagaatcgaacagctgtatccg
ttcccggcaaaagatacgaaggagcttttcgccaaactgccgaacctgcaagagatcgtt
tgggttcaggaagagccgcagaacatgggggcatggagttatatcagcccgtatctgacg
gaaatcgcgccaaaaggagtaaatgtccaatacatcggccgaagaagacgatccagtccc
gcagaaggagatccgacagtccacaaaaaagaacaggaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system