KEGG   Bacillus velezensis NAU-B3: BAPNAU_1924
Entry
BAPNAU_1924       CDS       T02859                                 

Gene name
yxjF
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00072  Synthesis and degradation of ketone bodies
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_1924 (yxjF)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BAPNAU_1924 (yxjF)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BAPNAU_1924 (yxjF)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N 3Beta_HSD RmlD_sub_bind B12-binding Methyltransf_25 DFP NAD_binding_10 NmrA GDP_Man_Dehyd Ubie_methyltran 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: CDH95705
LinkDB
Position
2012968..2013753
AA seq 261 aa
MHSLLIEKTAVVTGAAGGIGLEIAKEFAREGAAVIISDVNEQAGKEAAARLKDEGCEAVS
ITCDVTNEKQVADMLQTVEKQFGRLDILVNNAGIQHVAPIEEFPTEQFERLIRLMLTAPF
IAMKHAFPIMKKQQFGRIINMASVNGLIGFHGKAAYNSAKHGVIGLTKVGALEGAADGIT
VNALCPGYVDTQLVRNQLKDISATRNVPYERVLEDVIFPLVPQKRLLSVKEIADYAVFLA
SDKAKGVTGQAVVMDGGYTAQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcattcattgcttattgaaaaaacagccgttgtaacaggagcagccggaggaatcggg
cttgaaatcgcaaaagaattcgcccgtgaaggagcagccgtcatcatctctgatgtaaac
gaacaagcggggaaagaagcggcggcaagactgaaagatgaaggctgtgaagcagtcagc
atcacatgcgatgtaacaaatgaaaaacaagtggccgacatgctgcagacggtcgagaaa
caattcggacgtctcgatatccttgtgaataatgcgggcattcagcatgtcgcgcccatc
gaggaatttcccaccgaacagtttgaacggctcattcgtctcatgctgactgcgccattt
atcgcaatgaagcatgcattccccattatgaaaaaacagcaattcggtcgaatcattaat
atggcgtctgtcaacggactgatcggttttcacgggaaagcggcatataacagcgccaag
cacggcgtcatcggtttaacgaaagtcggcgcacttgaaggcgcggctgacggcattacc
gtcaatgcgctttgtccgggatatgtggacactcagcttgtccgcaatcagttaaaggac
atttccgcaacaaggaatgtaccgtacgaacgggtgcttgaggacgtgatctttccgctc
gttccccaaaaacggctgctgtcagtgaaggaaatcgctgattacgccgtatttttggcc
agcgacaaagcaaaaggggtcacaggtcaggccgtagtcatggacggcgggtataccgct
caatag

DBGET integrated database retrieval system