KEGG   Bacillus velezensis NAU-B3: BAPNAU_1962
Entry
BAPNAU_1962       CDS       T02859                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01210  2-Oxocarboxylic acid metabolism
bamb01230  Biosynthesis of amino acids
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_1962 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_1962 (acnA)
Enzymes [BR:bamb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     BAPNAU_1962 (acnA)
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: CDH95743
LinkDB
Position
complement(2083062..2085788)
AA seq 908 aa
MTNQQKVATQDVFQARKTFSSNGKTYNYYSLKALEDAGVGNVSKLPYSIKVLLESVLRQV
DGRVITKEHVENLARWGTAELKDIDVPFKPSRVILQDFTGVPAVVDLASLRKAMASVGGD
PDKINPEIPVDLVIDHSVQVDKAGTEDALAINMDLEFERNAERYKFLSWAKKAFNNYQAV
PPATGIVHQVNLEFLASVVHTKEEDGELVTYPDTLVGTDSHTTMINGIGVLGWGVGGIEA
EAGMLGQPSYFPVPEVIGAKLVGKLPNGTTATDLALKVTQVLREKGVVNKFVEFFGPGVA
ELPLADRATIANMAPEYGATCGFFPVDEEALSYLRLTGREEEQIDIVEAYCRNNGLFYTP
DAEEPIFTDVVEIDLSKIEANLSGPKRPQDLIPLSVMQETFKKHLVSPAGNQGFGADAAE
ENKEISFKLNSGEDAVMKTGAIAIAAITSCTNTSNPYVLIGAGLVAKKAVELGLKVPNYV
KTSLAPGSKVVTGYLVNSGLLPYMKELGFNLVGYGCTTCIGNSGPLSPEIEEAVAKNDLL
ITSVLSGNRNFEGRIHPLVKGNYLASPPLVVAYALAGTVNINLKTDPIGVGNDGQNVYFD
DIWPSMDEINSLVKQTVTPELFRKEYETVFDDNQRWNEIETTDEALYKWDKDSTYIQNPP
FFEEMSVEPGKVEPLRGLRVVGKFGDSVTTDHISPAGAIGKDTPAGKYLQEKGVSPRDFN
SYGSRRGNHEVMMRGTFANIRIKNQIAPGTEGGYTTHWPTGKVTSIYDACMRYKEDKTGL
VVLAGKDYGMGSSRDWAAKGTNLLGIRTVIAESFERIHRSNLVFMGVLPLQFKQGENADT
LGLTGKEVIEVDVDESVRPRDLLTVRAISEDGTVKTFEVVVRFDSEVEIDYYRHGGILQM
VLRDKMKQ
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgacaaatcagcaaaaagtcgcaacacaagacgttttccaagcaagaaaaacattttct
tcaaatgggaaaacatacaactactattcattaaaagcattggaagacgcaggggtcggc
aatgtttcaaaacttccttattctattaaggttcttttggaatctgttttgcgtcaggta
gacggacgtgtcattacaaaagaacatgttgaaaatttagcaagatggggtactgctgaa
ttaaaagatatcgatgtgccgtttaaaccgtcacgggttattctacaggactttaccggc
gttccggccgtagttgacctggcatctttaagaaaagccatggcttctgtcggcggagac
cctgataaaatcaatcctgaaattccggttgacctggtcattgaccactccgtacaagtc
gacaaagccggtacggaagacgcgttagccattaatatggacttagaattcgaaagaaat
gcagaacgttataaatttttaagctgggcaaagaaagcgtttaacaattatcaggctgtt
ccgcctgcaacaggtatcgttcaccaggtaaaccttgagtttttggcaagtgtcgttcat
acgaaagaggaagacggagaacttgtgacatatcctgatacattggtgggaacagattcc
catacaacaatgattaacggaatcggtgtcctcggctggggtgtcggcggtattgaggcg
gaagcgggaatgctcggccagccttcatatttccctgttcctgaggtcatcggcgcgaaa
cttgtcggaaaattgcctaacggaacgacggcgactgacttggcgctgaaagtcactcaa
gtgctgcgcgaaaaaggcgtagtcaataaatttgttgaattcttcggtcctggtgttgct
gagcttccgcttgcggatcgtgcgactattgccaatatggcgccggaatacggagcgact
tgcggattcttccctgttgacgaggaagcactttcttacctgcgtctgaccggccgtgaa
gaagagcagatcgatattgtggaagcatactgccgcaacaacggtttattctatacgcct
gacgcggaagagccgatttttacagacgttgtggaaattgatctgtcaaaaatcgaagcg
aacctttcaggaccgaaacgtccgcaggatttaatcccgctttccgttatgcaggaaacg
tttaaaaaacatcttgtcagcccggccggcaaccaaggattcggagcggatgctgctgaa
gagaacaaagaaatttcatttaaacttaacagcggtgaagatgcggttatgaaaacaggg
gcgattgcaatcgccgctattacaagctgtacgaatacatcaaacccttatgtactaatc
ggtgccggattggtagccaaaaaagcggtagaattaggcttgaaagtgccgaattatgtt
aaaacatcacttgcaccggggtctaaggttgttactggatacttagtcaactcaggcctg
cttccttacatgaaggagctcggctttaacctcgtagggtatggctgtacgacatgtatc
gggaactccggcccgctttctccagagattgaagaagcggttgctaaaaatgatctcttg
atcacttctgtcttgtcgggtaacagaaactttgaaggccggatccatccgcttgtcaaa
ggaaactaccttgcgtcacctccgcttgttgtcgcatacgcattagcaggcactgtgaat
atcaacctgaaaacggatccgatcggtgtcggaaatgacggacaaaatgtttatttcgat
gacatctggccgtccatggatgaaatcaattctctcgtcaaacagactgttacgccggaa
ttattccgcaaagagtatgaaacggtatttgacgacaaccagcgctggaacgaaatcgaa
acgacggatgaagcgctgtacaagtgggataaggattccacttacattcaaaacccgccg
ttctttgaggaaatgtctgtagagccgggaaaagttgagcctttaagaggacttcgcgtt
gtcggcaaattcggcgattccgtgacgactgaccacatttctccggccggagcgatcgga
aaagacacaccggcgggcaaatacctgcaggaaaaaggcgtttctcctcgtgactttaac
tcttacggctcacgccgcggaaaccatgaagtcatgatgagaggaacattcgccaatatc
cgcattaaaaaccaaatcgcaccgggtacagaaggcggatacacaacacattggcctacc
gggaaagtgacatctatttatgatgcctgcatgcggtataaagaagataaaacgggtctt
gtcgtcctggccggaaaagattacggaatgggctcttcacgtgactgggctgcaaaagga
acaaacctgctcggcatcagaacagtcattgccgaaagctttgaaagaattcacagaagc
aacctcgtcttcatgggtgtgctgccgcttcagttcaaacagggtgaaaacgcggataca
ctcggcttaaccggtaaggaagtcatcgaggtggatgttgatgaatctgtacgtccgcgc
gacttgctgactgtcagagcaatcagtgaagacggtacggtaaaaacatttgaagttgtt
gtccgttttgacagtgaagtggaaattgattactatcgccacggcggcattttacaaatg
gtgcttcgcgataaaatgaaacagtag

DBGET integrated database retrieval system