KEGG   Bacillus velezensis NAU-B3: BAPNAU_2158
Entry
BAPNAU_2158       CDS       T02859                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00640  Propanoate metabolism
bamb00660  C5-Branched dibasic acid metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2158 (sucD)
   00640 Propanoate metabolism
    BAPNAU_2158 (sucD)
   00660 C5-Branched dibasic acid metabolism
    BAPNAU_2158 (sucD)
Enzymes [BR:bamb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BAPNAU_2158 (sucD)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-ProteinID: CDH95938
LinkDB
Position
complement(2334324..2335226)
AA seq 300 aa
MSVFINKDTRVIVQGITGSTALFHTKQMLEYGTNIVGGVTPGKGGTEAEGVPVFNTVAEA
VHTTGADASVIYVPAPFAADAIMEAVDAEIDLVICITEHIPVLDMVKVKRFMEGKKTRLI
GPNCPGVITPEECKIGIMPGYIHKRGHVGVVSRSGTLTYEAVHQLSEAGVGQSTAVGIGG
DPVNGTNFIDVLKAFNEDPETHAVIMIGEIGGTAEEEAAEWVKANMTKPVVGFIGGKTAP
PGKRMGHAGAIISGGKGTAEEKVKTMNACGIEVAETPSVMGETLIKVLKEKGLFETCKTH
NT seq 903 nt   +upstreamnt  +downstreamnt
atgagtgtttttatcaataaagatacaagagttattgtacaggggattacaggttctacc
gctttatttcatacaaagcagatgctggaatacggcacgaatatcgttggcggtgtaaca
cctggaaaaggcggaacggaagcggaaggcgtaccggtattcaatacggtcgcagaagcg
gttcatacaacgggcgctgatgcgtcagttatttacgtgccggctccgtttgcggcggac
gcaattatggaagcggttgacgcggaaattgatcttgtcatttgtatcactgagcacatt
ccggttttggacatggtgaaggtgaagcgctttatggaaggcaagaaaacgagattaata
gggccgaactgcccgggtgttattacacctgaagaatgcaagatcggcattatgccggga
tacattcataaaaggggccatgtaggcgttgtatcccgttcaggaacattgacatacgag
gccgtccatcagctttcagaagccggcgtaggccaatctaccgctgtagggatcggcggc
gatccggtcaacggcacgaactttattgacgtgttaaaagcgttcaatgaagatcctgaa
acacatgccgtcatcatgatcggagaaatcggcggcacagctgaagaagaagcggctgag
tgggtgaaagcgaacatgacgaagcctgttgtcggctttatcggcggtaaaaccgcgcct
ccgggaaaacgcatgggccacgcgggcgccatcatctccggaggaaaaggcacggcagaa
gaaaaagtcaaaacgatgaacgcctgcggaattgaagtcgcggaaaccccttctgtaatg
ggtgaaacgttgattaaggtgttaaaagaaaaaggcttatttgaaacgtgcaaaacgcac
tga

KEGG   Bacillus velezensis NAU-B3: BAPNAU_2159
Entry
BAPNAU_2159       CDS       T02859                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00640  Propanoate metabolism
bamb00660  C5-Branched dibasic acid metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2159 (sucC)
   00640 Propanoate metabolism
    BAPNAU_2159 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BAPNAU_2159 (sucC)
Enzymes [BR:bamb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BAPNAU_2159 (sucC)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Other DBs
NCBI-ProteinID: CDH95939
LinkDB
Position
complement(2335255..2336412)
AA seq 385 aa
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESLSSSVYVVKAQIHAGGRGKAGGV
KIAKTKDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LNESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatacggggtgtctgttcct
gaaggtaaagtggcttttacagcagaggaagcagttgaaaaagcagagagcctgtcaagc
tcggtttatgtcgtaaaggcgcaaatccatgctggcggccgcggcaaagctggtggggta
aagattgcaaaaacaaaagatgaagtgaaagagtatgccgaagaactgttaggcaagacg
ctcgtcacacatcaaacgggtccggacggacaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaggaatactatgtcgggcttgtacttgaccgcgctacttcaaga
atcgttttaatggcgtctgaagaaggcggaacggagattgaagaagtagcggaaaaaaca
cctgaaaaaattaaaaaagcggtaattgatccggctgtcggccttcagggctatcaggca
agggaaattgcattcgcaattaacatcccgaaagagcttgtcggcaaagccgctaaattt
atgctcggtttatacaaagcatttgttgagaaggactgctccatcgccgagatcaaccct
ctcgtcgttacgggggacggaaacgtcatggcgctggatgctaagctgaacttcgacagc
aatgcgttatacagacaaaaagacattatggaatacagagatttagatgaagaagatccg
aaagaaatcgaagcgtcaaaatacgatttaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggtcttgcaatgtctacaatggatatcattaaacactacggc
ggagaacctgcaaacttccttgatgtcgggggcggcgcaaccgcagaaaaagttacggaa
gcttttaaaatcattctttccgatcaaaacgtaaaaggaattttcgttaatattttcgga
ggcatcatgaagtgtgatgtcatcgccgagggcgttgttgaagcgacgagacaagtcgga
ttgacattgccgctggtcgtgcgccttgaagggacaaacgtagatttaggaaagaaaatc
ctgaatgaatcaggcttaaacatcacatctgcggaatcaatggcagacggcgcacagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system