KEGG   Bacillus velezensis NAU-B3: BAPNAU_2282
Entry
BAPNAU_2282       CDS       T02859                                 

Gene name
pycB
Definition
(GenBank) pyruvate carboxylase subunit A
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2282 (pycB)
   00620 Pyruvate metabolism
    BAPNAU_2282 (pycB)
Enzymes [BR:bamb01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BAPNAU_2282 (pycB)
SSDB
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ATPgrasp_Ter
Other DBs
NCBI-ProteinID: CDH96062
LinkDB
Position
complement(2457878..2461147)
AA seq 1089 aa
MSQQSIQKVLVANRGEIAIRIFRACTELNIRTVAVYSKEDSGSYHRYKADEAYLVGEGKK
PIDAYLDIEGIIEIAKRNGVDAIHPGYGFLSENIQFARRCEEEGIVFIGPTSAHLDMFGD
KVKAREQAEKAGIPVIPGSDGPAETLKDVEQFAKVHGFPFIIKASLGGGGRGMRIVRSES
ELKESFERAKSEAKAAFGNDEVYVEKLIENPKHIEVQVIGDKEGNVVHLYERDCSVQRRH
QKVIEVAPSVSLQPELRDEICEAAVALAKNVGYINAGTVEFLVAGGEFYFIEVNPRVQVE
HTITEMITGVDIVQTQILVAQGHGLHSRAVNIPEQKDIFTNGYAIQSRVTTEDPLNDFMP
DTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKLSTWALTFEQASAKMVRNLQE
FRIRGIKTNIPFLENVAKHEKFLTGQYDTSFIDTTPELFVFPKQKDRGTKMLSYIGNVTV
NGFPGIGKKEKPAFDKPQTVTLGIEEKPASGTKQILDERGAEGLADWVKEQKSVLLTDTT
FRDAHQSLLATRIRSNDLKKIANPTAALWPELFSLEMWGGATFDVAYRFLKEDPWKRLED
LRKEVPNTLFQMLLRSSNAVGYTNYPDNVIQKFVRQSAESGIDVFRIFDSLNWVKGMTLA
IDAVRETGKVAEAAICYTGDILDKTRTKYDLKYYLSMAKELEASGAHILGIKDMAGLLKP
QAAYELISALKETIDIPVHLHTHDTSGNGVFLYAKAVEAGVDIVDVAVSSMAGLTSQPSA
SGFYHALEGNSRRPEMDVRQVERLSQYWESVRQYYSEFESGMKSPHTEIYNHEMPGGQYS
NLQQQAKGVGLGDRWNEVKDMYSVVNRMFGDVVKVTPSSKVVGDMALYMVQNNLTEQDVY
DKGETLDFPDSVVELFKGQIGQPHGGFPEKLQKLVLKGQTPITVRPGELLEPVSFEGIKE
EWKETHQMELSDQDAIAYALYPKVFTEYVKTAERFGDISVLDTPTFFYGMTLGEEIEVEI
ERGKTLIVKLVSIGEPQPDATRVVYFELNGQPREVVIKDESIKSSVQEKLKSRSDKPKPH
CGIHAGNRH
NT seq 3270 nt   +upstreamnt  +downstreamnt
ttgtcacaacaatccatccaaaaagtgttagtagcaaacaggggagaaattgcgatccgg
attttccgggcgtgcacagaattgaacatcagaacggtagccgtttattcaaaagaagat
tcgggctcctatcatcgctataaagcggatgaagcttatcttgtgggagaaggcaaaaaa
ccgattgacgcgtatcttgatattgaagggattattgagatcgcaaaaagaaacggcgtt
gatgccattcatccgggctacggatttctctctgaaaatatccaatttgcgaggcgctgt
gaagaagagggcatcgtatttatcggaccgacgtcagcgcatttggatatgttcggagat
aaggtaaaggcgagggagcaggcagaaaaagccggcatccccgttattccggggagtgac
ggaccggctgaaacattaaaagatgtcgaacaattcgcaaaagtccacggatttccgttt
attattaaagcatcgctcggaggcggaggccgcggaatgagaatcgtcagaagcgaaagc
gaattgaaagaatcgtttgagcgggccaaatcagaagcgaaagccgcattcggaaacgat
gaagtgtatgttgaaaaactgatcgaaaatcctaagcatattgaagttcaggtgatcgga
gataaagaaggcaatgtcgtccatctgtatgagcgggactgttccgttcagagacgccat
caaaaggtcattgaggtggcgccgagtgtatctttgcagcctgaattaagggacgaaatc
tgtgaagcggctgtggcgcttgcgaaaaatgtcggctatatcaacgcggggaccgtggaa
tttctcgtagcgggcggtgaattttactttattgaagtgaacccgcgcgtacaagtggag
catacgattacggaaatgataacgggggttgatatcgttcagacgcaaatcctcgtcgcg
cagggccacggactgcacagccgtgccgtcaatatccctgagcagaaagacatttttaca
aacgggtatgcgatccaatcacgtgtgactactgaagatccgctgaatgactttatgcct
gacacgggtaaaattatggcttaccgctcaggcggcggcttcggcgtccgccttgatacg
ggaaacagcttccagggcgccgtcatcacgccttattatgattcactgctcgtcaagctg
tcgacatgggcgctgacgtttgaacaggcatcagcaaaaatggtccgcaacctgcaggaa
ttcaggatcagaggcattaagaccaatattccgtttcttgaaaacgtggcaaagcatgaa
aaattcctgacgggccaatacgacacatcgtttatcgacacaacgcctgagctgtttgtt
ttcccaaaacagaaggaccgcggaacaaaaatgctttcctatatcggcaatgtcacggtg
aacggttttccgggaatcgggaaaaaagaaaaacctgcatttgataagcctcagaccgtt
acgttaggtatcgaagaaaagccggcaagcggtacgaaacagatccttgatgaaagaggc
gctgaggggcttgcagactgggtgaaagagcaaaaatccgtgctcctgaccgatacaacg
ttcagggatgcccatcagtccctgcttgcaacccggatcagatccaatgatttgaaaaaa
atcgcgaatcctacggctgccctgtggcctgaactgttcagccttgaaatgtggggaggc
gcgacatttgatgtagcgtaccgtttcttaaaagaagacccttggaaacgccttgaagat
cttcgcaaggaagtgccgaacacattgttccagatgctgcttcgttcatcaaatgccgtc
ggttatacaaactatccggacaatgtcatccaaaaatttgtccggcagtcagcggagtca
ggtattgacgtattccggatctttgacagcctgaactgggtaaaagggatgacgctggcc
atcgatgccgttcgtgaaaccggaaaagtggcggaggctgcgatttgttacacgggagat
attcttgataagacccggacgaaatatgatttgaagtattatctttctatggcgaaagag
cttgaggcgtctggtgcgcacattctcggcattaaagacatggccggtcttttgaaacct
caagccgcatacgaacttatctcagcgctgaaggaaacgattgatattcccgttcatctt
cacacgcatgatacgagcggcaatggcgtctttctctatgccaaagctgttgaagcgggt
gtggacatcgtggatgtcgccgtcagctcaatggcgggtctgacttcacagccgagcgca
agcggattttatcatgcccttgaaggaaacagccgccgtcctgaaatggatgtccgccag
gtggaaagactgtcacaatactgggaatccgtccgtcagtattacagtgaatttgaaagc
gggatgaagtctcctcatactgagatttataatcatgaaatgccgggcggccagtacagc
aatctgcagcagcaggcaaaaggagtcggcctcggtgatcgctggaatgaggtgaaagac
atgtacagcgtcgtcaaccgcatgttcggcgacgtcgtgaaagtaacaccttcttccaaa
gtcgtcggagatatggcgctttacatggtgcaaaacaatttaacagaacaagatgtttat
gataaaggcgaaacgcttgattttccggattcagtcgttgagctctttaaagggcagatc
ggccagccgcacggcggatttccggaaaaactgcaaaagctcgttctgaaaggacagacg
ccgatcacggtaagaccgggtgagctgcttgaaccggtatcttttgaaggcattaaagaa
gaatggaaagaaacacatcagatggaattgagtgatcaggacgcaatcgcgtatgctctt
tatccgaaggtgtttacagaatatgttaaaacggctgaacgcttcggtgatatttccgta
ttggacacaccgactttcttctacggcatgacactcggtgaagaaatcgaagtggaaatc
gagcgcggaaaaacgctgatcgtgaagcttgtatctatcggtgaaccgcagccagatgcg
acacgtgtcgtttatttcgaattgaacggccagccgcgcgaggtggtcattaaagatgaa
agcataaaatcgtccgtacaggaaaaattaaaaagcagatcggacaaacccaagccacat
tgcggcatccatgccgggaaccgtcattaa

DBGET integrated database retrieval system