KEGG   Bacillus velezensis NAU-B3: BAPNAU_2427Help
Entry
BAPNAU_2427       CDS       T02859                                 

Gene name
mtnE
Definition
(GenBank) transaminase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00270  Cysteine and methionine metabolism
bamb01100  Metabolic pathways
Module
bamb_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BAPNAU_2427 (mtnE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bamb01007]
    BAPNAU_2427 (mtnE)
Enzymes [BR:bamb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BAPNAU_2427 (mtnE)
Amino acid related enzymes [BR:bamb01007]
 Aminotransferase (transaminase)
  Class I
   BAPNAU_2427 (mtnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CDH96207
LinkDB All DBs
Position
complement(2632327..2633523)
Genome map
AA seq 398 aa AA seqDB search
MNFEISDVLKQLPEQFFASLVQKVNQKLKEGRDVINLGQGNPDQPTPQHIVEEMKRAVER
PENHKYSSFRGAYSFKKAAAAFYEREYGVTLDPETEVAVLFGGKAGLVELPQCLLNPGDT
ILVPDPGYPDYWSGVALAKAKMEMMPLTEERGFLPDYSVIPEKVRSEAKLLYLNYPNNPT
GAVATEAFFEETVGFAEQNGICVVHDFAYGAVGFDGHKPLSFLQTEGAKETGIEIYTLSK
TYNMAGWRVGFAVGNASVIEAINLYQDHMFVSLFPAAQQAAAAALLADQACVAAQNDRYE
SRRNAWIEACRDIGWDVTAPAGSFFAWLPVPDGYTSQSFSDLLLEKADVAVAAGNGFGKW
GEGYIRVGLLTSEERLKEAAERIGKLNLFTRKSIDISG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaatctcagatgtactcaaacagctgccggaacaatttttcgcatcattg
gtgcaaaaagtgaatcaaaagctgaaagaaggcagagacgtcatcaatttagggcaggga
aaccctgatcagccgacgcctcagcatatcgttgaagaaatgaagcgcgccgtcgaaagg
ccggaaaatcataaatactcatcattccggggcgcttacagcttcaaaaaagcagccgct
gcattttatgaaagggagtacggggtcacgcttgatccggaaacggaagtcgccgtgctg
ttcggaggcaaggcgggacttgttgagcttccgcaatgtcttttaaaccctggagatacc
attctggtgcctgatcccggatatcctgattactggtcaggcgtcgcccttgcgaaagcg
aaaatggaaatgatgccgctgacggaggaaagagggtttctccctgattacagcgtaatt
cctgaaaaggtgcggagcgaggcgaagctgctgtatctcaattatccgaataatccgacc
ggcgctgtggcgacagaggcgtttttcgaggagacggtcggttttgcggagcaaaacggc
atttgtgtcgttcatgatttcgcgtacggagccgtcggctttgacgggcataaaccgctg
agctttttgcagaccgaaggcgcaaaagagacgggaatcgaaatctataccttgtctaaa
acctataatatggcgggctggcgggtcggatttgccgtcggaaacgcttctgtcatcgaa
gcgatcaacctttatcaggatcatatgtttgtcagtttgtttcccgcggcgcagcaggcg
gcggcagccgctcttttagcggatcaggcatgcgtcgcagcgcaaaatgacagatatgaa
tcgagacgcaatgcatggattgaagcctgccgcgatatcggctgggatgtgacggctccg
gcgggctccttttttgcatggctccctgtgcctgacggttatacgtcacagtcgttttca
gacctgctgctcgagaaagcggatgtcgcggtcgctgccggaaacgggttcggaaaatgg
ggggaaggctatataagagtcggtcttctgacaagtgaagaaagacttaaagaagctgcg
gaacggatcgggaaactgaatcttttcacccgaaaaagcattgacatatcaggataa

DBGET integrated database retrieval system