KEGG   Bacillus velezensis NAU-B3: BAPNAU_2785Help
Entry
BAPNAU_2785       CDS       T02859                                 

Gene name
yhaM
Definition
(GenBank) 3'-5' exoribonuclease yhaM
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
bamb  Bacillus velezensis NAU-B3
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bamb03019]
    BAPNAU_2785 (yhaM)
Enzymes [BR:bamb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BAPNAU_2785 (yhaM)
Messenger RNA biogenesis [BR:bamb03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BAPNAU_2785 (yhaM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD tRNA_anti-codon TraI_2
Motif
Other DBs
NCBI-ProteinID: CDH96565
LinkDB All DBs
Position
complement(2953585..2954529)
Genome map
AA seq 314 aa AA seqDB search
MAKGIMLHEVGEQVDQYFLIKSSTKGIASNGKPFLTLMLQDQSGDIEAKLWDAKPTDEVT
YAAQTIVKVIGDVHHYRGRNQLKLRNIRPAGENENVSIDDFLETAPIPKNEMMETVTQYI
FEMKNPNIQRITRHLVKKYAAEFMDYPAAAKNHHEFVSGLAYHVVSMLNLAKAIADLYPS
LDRDLLYAGVILHDLGKVKELSGPVSTTYTVEGNLLGHISIMVTELSKAAEELQIDAEEV
LILKHLILSHHGKAEWGSPKPPMVKEAEILHYIDNLDAKMIMMDRALERVKPGEYTERVF
ALENRSFYKPTFHQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtattatgctgcacgaggtcggcgagcaggtcgatcaatactttctgatt
aaatcttcgactaaaggaatcgcaagcaacggaaaaccattcctgacgttaatgctgcag
gaccaatcgggagatatcgaagcgaagctgtgggatgccaagccgactgatgaagtaacg
tacgcggcgcagacgatcgtgaaggtgatcggagatgtccatcactatcgcggacgaaac
cagcttaagctgagaaacatccggccggccggcgagaacgaaaatgtcagcattgatgat
tttctggaaacggcgccaattccgaaaaatgaaatgatggaaaccgtcactcaatacatt
tttgaaatgaaaaatccaaacatccagcggatcacaagacatctggtcaaaaaatatgcg
gctgagtttatggattacccggctgcggctaaaaaccaccatgagttcgtctccgggctc
gcgtatcatgtagtgtccatgctgaacctggcaaaagcgattgccgatctgtatccgtct
cttgaccgggatttactgtatgccggagtcattctgcatgatctcggcaaagtaaaagag
ctttcaggccccgtctccacaacgtacaccgtggaagggaatctgctcgggcacatttcg
atcatggtgacagagctttcaaaagcagccgaagagcttcagattgacgctgaagaagtg
ctgattctgaaacatttgattttaagccatcacggaaaagcggaatggggaagcccgaaa
ccgccgatggtgaaagaagcggaaattctgcactacattgataatctggatgcaaaaatg
atcatgatggacagagcgctggaacgggtgaagccgggcgaatacacagagcgtgtattt
gcgcttgaaaaccgttctttctacaaaccgactttccatcaataa

DBGET integrated database retrieval system