KEGG   Bacillus velezensis NAU-B3: BAPNAU_2921
Entry
BAPNAU_2921       CDS       T02859                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_2921 (pckA)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2921 (pckA)
   00620 Pyruvate metabolism
    BAPNAU_2921 (pckA)
Enzymes [BR:bamb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BAPNAU_2921 (pckA)
SSDB
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33
Other DBs
NCBI-ProteinID: CDH96701
LinkDB
Position
3091440..3093023
AA seq 527 aa
MKLVDLTADLQALLASPNVHHNLSAPKLTEKVISRNEGTLTSTGAVRATTGAYTGRSPKD
KFIVREQSTENQIDWGAVNQPISEEAFEKLYAKVVSYLKQRDELFVFEGFAGADEKYRLP
ITVVNEFAWHNLFARQLFIRPETDERDPQAQPFTILSAPHFKADPETDGTHSETFIIVSF
EKRVILIGGTEYAGEMKKSIFSIMNFLLPQQDILPMHCSANVGEKGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDSGVFNIEGGCYAKCINLSEEKEPQIFRAIRFGSVLENVVL
DEKTGEADYDNSFYTENTRAAYPIEMIGNIVQPSIAGHPQAIVFLTADAFGVLPPISKLT
KEQAMYHFLSGYTSKLAGTERGVTSPQTTFSTCFGSPFLPLPAHVYAEMLGHKIDEHGVQ
VFLVNTGWTGGGYGVGERMKLSYTRAMVKAAIEGRLNQTDMTADSIFGLRSPVHVPGVPD
EVLQPENTWSDKQAYNEKALFLANEFKENFKKFSHADSIAKAGGPLV
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgaaattagttgatttaaccgcagatcttcaagcattacttgcaagtccgaatgtgcat
cataatttatcggctccaaaacttaccgaaaaagtgatcagccgaaatgaaggaacgctg
acatcaacgggcgccgtacgcgccaccaccggcgcttatacaggcaggtcacctaaagat
aaatttatcgtccgtgaacaaagcacagaaaatcaaattgattggggcgcggtgaatcag
cccatttctgaagaggcgtttgaaaagctgtacgccaaagtcgtcagctacttaaaacag
cgggatgaactgtttgtttttgaaggattcgcaggagcggatgaaaaatacagactcccg
attacggtcgtaaatgaatttgcgtggcacaatttattcgcacgccagctgtttatcaga
ccggagacggatgaaagagatccgcaagcgcagcctttcaccattctctcggctccgcat
tttaaagcagatccggagacggacggcacgcattcggaaacatttatcattgtctctttc
gaaaagcgcgtcattttaatcggcggcaccgaatacgccggagaaatgaaaaaatcaata
ttctccattatgaacttcctgcttccgcagcaggatatactgccgatgcactgctcagcc
aatgtcggtgaaaaaggcgatgtcgccctgtttttcggtctttccggcacagggaaaacg
acgctttcagccgatgcggaccgcaaactgatcggcgatgacgagcacggctggtcagat
tccggcgttttcaacattgaaggcggatgttacgctaaatgtatcaatctgagcgaggaa
aaagaaccgcagatttttcgtgcgatccgcttcgggtctgttcttgagaatgtcgtgctt
gatgaaaaaacgggtgaagcggattacgataattccttctacacggaaaacacaagagcc
gcatatccgattgagatgatcggcaatatcgtgcagccgagcattgccggccatccgcag
gcaatcgtctttttaacggcggacgcattcggtgtgctccctccgatcagcaaactgacg
aaggaacaggcgatgtatcacttcttaagtgggtacaccagtaaactcgcgggaaccgag
cgcggcgtgacatctccgcaaacgactttctcgacgtgcttcggttcaccgttccttccg
cttccggcgcatgtatatgccgaaatgctcgggcataaaatcgacgaacacggcgttcaa
gtcttcttggtcaacacaggctggaccggcggagggtacggagtcggagaacggatgaaa
ctttcgtatacaagagcgatggtcaaggccgctattgaaggcaggctgaaccagactgac
atgacggcagacagcattttcggcctgcgcagtcccgttcatgttccgggcgttccggat
gaagttcttcagcctgaaaacacatggagcgataaacaagcatacaacgaaaaagcgctg
tttttagccaatgagtttaaagaaaactttaaaaagttttcccatgcagactcgattgcc
aaagccggcggacctctcgtgtaa

DBGET integrated database retrieval system