KEGG   Bacillus velezensis NAU-B3: BAPNAU_3065Help
Entry
BAPNAU_3065       CDS       T02859                                 

Gene name
yueG
Definition
(GenBank) putative protein yueG
  KO
K06299  spore germination protein PA
Organism
bamb  Bacillus velezensis NAU-B3
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAPNAU_3065 (yueG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: gerPA
Motif
Other DBs
NCBI-ProteinID: CDH96845
LinkDB All DBs
Position
complement(3236978..3237199)
Genome map
AA seq 73 aa AA seqDB search
MPAIVGPIYIMSLAGDAAASFGDVFAISPKAVDHSGAGAGAFHSGDFIKVTNKFSKTRFE
DIDVFDEPDWFNA
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaattgtgggaccgatttatattatgagtttagccggagacgctgcggcgagc
ttcggtgacgtgtttgccatttctcccaaagccgttgaccactcaggcgcgggggcaggg
gcgtttcattccggagattttatcaaagtcactaataaattcagcaaaacgcgctttgaa
gacatcgatgtgtttgacgaacctgattggttcaacgcgtga

DBGET integrated database retrieval system