KEGG   Bacillus velezensis NAU-B3: BAPNAU_3174
Entry
BAPNAU_3174       CDS       T02859                                 

Gene name
fadN
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00071  Fatty acid degradation
bamb00362  Benzoate degradation
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_3174 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAPNAU_3174 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAPNAU_3174 (fadN)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BAPNAU_3174 (fadN)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Other DBs
NCBI-ProteinID: CDH96954
LinkDB
Position
complement(3345671..3348040)
AA seq 789 aa
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALIYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERLEEEGA
EIPGWVKDMLDQGHETFYMKENGTPFYYSDGQYRAVKENPKRISLQTLKETKGVITKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETDRNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLNGGSELMDAAIKTFETIALAKVSGSAHEARD
MQILSAADRVSMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcagg
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataacggcggggaatttggaagatgacgcagctcaattaaaggat
gctgattggattattgaagtcgtcgtcgaaaatcttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcatcgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgatctgccgattttaaagcccatttcttaggaacccat
ttctttaatccggcccgctacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgctcgggaaaggtgtcgtc
atcgcgaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgaccggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
actttcgcccatgtggcaaaaaatgtgtatgataaagccgacggcgctgaaaaagacatg
tttaagctgcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgatccgctgaccatg
acatacggtgagcgctcgaaaatgaagacgcccgctttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttatatactccgatgaccgcgccggacgcctgctt
tggaatattacatcgcaaacactcttatactcagcccggcttttaggtgagatcgctgat
gatatcaaagcgattgacgacgccatgaaatggggcttcggatgggagctcggcccgttt
gagatgtgggatgccatcggcgtcagaaaatcagcggagcggctcgaagaagaaggcgca
gaaatccccggctgggtgaaagatatgcttgatcagggccatgaaacattttatatgaag
gaaaacggaacaccattttactattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcaaacgttaaaagaaacaaaaggcgttatcactaaaaacagcggc
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaaccgatcggaat
tataaaggacttgtcatcggaaaccaaggcagacatttctgcgcgggggcaaaccttgcg
atgattttgatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtcgcggcgccattc
gggatgacactcggcggcggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtcttgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttgaacggcggaagtgaactgatggacgcggccatt
aaaaccttcgaaacaatcgcgcttgccaaagtgtccggttcggcacacgaagcccgtgat
atgcagattttgtccgcggcagaccgtgtcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgcccgcctgcccgcaaaaaa
gtgaaagtcaccggagaaaccggctgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcacggaggtttcagaagaatatttactcgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system