KEGG   Bacillus velezensis NAU-B3: BAPNAU_3177Help
Entry
BAPNAU_3177       CDS       T02859                                 

Definition
(GenBank) hypothetical protein
Organism
bamb  Bacillus velezensis NAU-B3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Herpes_UL25
Motif
Other DBs
NCBI-ProteinID: CDH96957
LinkDB All DBs
Position
3349340..3349657
Genome map
AA seq 105 aa AA seqDB search
MYEILIAEKAKKNRIEGGVYMNNQEQHGNLPPAVISTKDHLYLEDMLNWNLLAMKKAHFM
AEHCQNQTLKQELDQIGRMHQKHYQHILGRLNPDQGGQTTTGYMQ
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgaaatcctgatcgcagagaaagctaaaaagaacagaattgaaggaggcgtttat
atgaacaaccaagagcagcacggaaacttgccgcctgccgtcatctcaacgaaagaccat
ttgtatcttgaggacatgctgaactggaatctgcttgccatgaaaaaagcgcattttatg
gcggaacattgccagaatcagacgttaaaacaagagcttgatcagatcggccggatgcat
cagaagcattatcagcacatattgggccgcttgaaccccgatcaaggcggacagacaaca
acaggctatatgcaatag

DBGET integrated database retrieval system