KEGG   Bacillus velezensis NAU-B3: BAPNAU_3196
Entry
BAPNAU_3196       CDS       T02859                                 

Gene name
fumC
Definition
(GenBank) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_3196 (fumC)
   00620 Pyruvate metabolism
    BAPNAU_3196 (fumC)
Enzymes [BR:bamb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     BAPNAU_3196 (fumC)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C SpoIID
Other DBs
NCBI-ProteinID: CDH96976
LinkDB
Position
complement(3365439..3366827)
AA seq 462 aa
MDYRIEKDTMGEVKVPADKFWGAQTQRSKENFKIGSEKMPQRVVKAFAILKRSTAIANER
LGNLESEKAQAIAAVCDDVLNGKYDDNFPLVVWQTGSGTQSNMNMNEVVANRATALLKEK
NSELKIHPNDDVNRSQSSNDTFPTAMHVAAVLAVYEQLVPALDQLRATLDEKAKAYQDIV
KIGRTHLQDATPLTLGQEISGWVYMLDRSKEMILESTEKIRALAIGGTAVGTGINAHPQF
GEFVAEEITKVTGQTFKSSPNKFHALTSHDEITYVHGALKALAADLMKIANDVRWLASGP
RCGIGEIVIPENEPGSSIMPGKVNPTQSEALTMIAAQVMGNDATIGFAASQGNFELNVFK
PVIIYNFLQTVQLLSDGMNSFHDKCAVGIEPNQETIQENLSNSLMLVTALNPHIGYENAA
KIAKLAHKEGLTLKEAALQLNLLTEEQFNEMVRPEDMVHPKA
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggactacagaattgaaaaagacaccatgggagaagttaaagttccggcagataaattt
tggggcgctcagacacagcgcagcaaagagaacttcaaaatcggttcagaaaaaatgcct
cagcgtgttgtgaaggcgtttgcaatattgaaaagaagcacagcgatcgccaacgaacgc
ctcggcaacttagagtctgaaaaagcacaggcgattgccgctgtatgtgacgatgtttta
aacggcaaatacgacgataactttccgctcgttgtctggcagacgggaagcggcacgcaa
agcaacatgaacatgaatgaagtggtggccaaccgcgcgactgctttattgaaagaaaaa
aattccgagcttaagattcatccgaatgatgacgttaaccgcagccaaagctcaaacgat
acattcccgacggcgatgcacgttgcggcggttcttgccgtatatgagcagctcgttccg
gcgcttgatcagctgcgcgcgacgcttgatgaaaaagcgaaagcttatcaggatattgtg
aaaatcggacgcacgcatttgcaggacgccactccgctgacgctcggacaggaaatcagc
ggctgggtatacatgcttgaccgatcgaaagaaatgattcttgagtcaacggaaaaaatc
cgcgcgcttgccatcggaggcacggcagtcggcacgggaatcaacgcccatccgcagttc
ggtgaattcgtcgcggaagaaatcacaaaagtaacggggcagacattcaagagttcgcct
aacaaattccatgcgctcacaagccatgatgaaatcacttacgttcacggcgcgttaaaa
gcattggctgccgacctgatgaagattgccaacgatgtcagatggctggccagcggcccg
cgctgcggaatcggcgaaatcgtcattcctgaaaatgagccgggaagctctatcatgccg
ggtaaagtcaacccgacgcaaagtgaggcgctgacaatgatcgccgcgcaagtgatggga
aatgacgcgacaatcggatttgcggccagccaaggaaacttcgagctgaatgtcttcaaa
ccggttattatttataacttcctgcagaccgtgcagctgctcagtgacggaatgaattcc
ttccatgacaaatgcgctgtcggtattgagccgaaccaagagacgattcaggaaaatctc
tctaactcattaatgcttgttacggcgcttaacccgcacatcggttatgaaaacgccgcg
aaaatcgccaagcttgcccacaaagaaggcctgacgctgaaagaagcggcattacagctg
aaccttctgacagaagaacaatttaatgaaatggtgcgtccggaagatatggtgcacccg
aaagcataa

DBGET integrated database retrieval system