KEGG   Bacillus velezensis NAU-B3: BAPNAU_3794Help
Entry
BAPNAU_3794       CDS       T02859                                 

Gene name
cydD
Definition
(GenBank) Lipid A export ATP-binding/permease protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAPNAU_3794 (cydD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bamb02000]
    BAPNAU_3794 (cydD)
Transporters [BR:bamb02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BAPNAU_3794 (cydD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_29 AAA_21 AAA_16 RsgA_GTPase DUF87
Motif
Other DBs
NCBI-ProteinID: CDH97574
LinkDB All DBs
Position
complement(3972028..3973758)
Genome map
AA seq 576 aa AA seqDB search
MRKEEWILPYMKQNARLFVLVIFLGAVTIFSAAFLMFTSGFLISKSATRPENILLVYVPI
VAVRTFGIARSVSRYAERLTGHHIILKIVSDMRVRLYNMLEPASLMLSSRFRTGDMLGIL
AEDIEHLQDAFLKTIFPAVSALLLYAASVIGLGFFSWPFAAFAAIYLFILVVLFPVVSLL
VTRAKNMRLKSGRNMLYSRLTDAVLGVSDWMFSGRQAAFISSYEEKEKAWFDLESKRQRF
TRWRDLAAQCLVGGFILIMLFWTAGQYADGSIANTMIAAFVLVVFPLTEAFLPLSDALTE
VPSYQDSIKRMSKAAPELRSREVKQTDEKLDVSDVTLTFDNVTFSYDQHSHVLDRFSFTL
RQGEKMALLGRSGSGKSTSLALIEGALVPDSGKVMLNGLETAAVQEQISSAVAVLNQKPH
LFNTSIMNNIRLGNGKASDEDVKRAARQVKLHDYIESLPDGYETSVQETGIRFSGGERQR
IALARILLQDTPVIILDEPTVGLDAVTERELLDTIFDVFKEKTILWITHHLAGVETADKI
VFLENGKAEMEGTHQELLAENERYRKLYRLDVPIRT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagaagaatggattctgccgtatatgaagcaaaatgcccgtttgtttgttctt
gtgatttttttaggcgcggtgacgattttttcggcggcctttctcatgttcacttccggt
tttttgatctctaagtcggcgacaaggcctgagaatatcctgctggtgtacgttccgatt
gtggccgtgcgcaccttcgggattgcccgttcagtctcacggtacgccgagcgtctgacg
gggcaccatatcattttgaaaatcgtgtccgacatgagggtgcggctttacaatatgctg
gagccggcctcgctcatgctttcatcccgttttcggacgggcgacatgctcggcattttg
gctgaggatattgagcatttgcaggatgcgtttttaaaaacgattttcccggcggtttcc
gctttgctgctgtatgcggcctccgttatcggactcggctttttttcctggccgtttgcc
gcttttgcggcgatttacctgtttatattggttgtattgtttccggttgtgtcgcttctt
gtgacgagagcgaaaaacatgaggctgaaaagcggccggaatatgctctacagccggctg
acagatgccgtgctcggcgtgagcgactggatgttttcgggacgccaggcggcctttatt
tcctcttatgaagagaaagagaaggcatggtttgaccttgaaagcaaacgtcagcggttt
acaagatggcgtgatctcgccgcgcaatgtcttgtcggcggcttcatattgatcatgctg
ttctggacggcgggtcagtatgcggacggcagcatcgccaacacgatgatcgcggccttt
gtgcttgtcgtatttccattgacggaggcgtttctgcccctttcggatgcgctgacggaa
gtgccttcttatcaggattccatcaaaagaatgagtaaggcggctccggagctgcgaagt
cgtgaggtgaagcagacggatgagaaactggatgtatctgatgtgacacttacatttgat
aacgtgacgttttcttatgatcagcacagtcatgtgcttgaccgtttttccttcactctc
cgccaaggtgaaaaaatggcgttgctcggcaggagcggttccggtaagtcgacctctctc
gctttaattgaaggcgccttagttcccgattcgggcaaagtgatgctgaacgggctggaa
actgcggccgtgcaggagcagatttcctcagcggtggccgttttgaatcagaaacctcat
ctctttaacacgagcattatgaacaatatccggctcggaaacggcaaggcgagtgatgaa
gatgttaagcgtgcggcgcggcaagtgaagctgcatgattatattgaatcactgcctgac
ggatatgaaacgtccgtgcaggagacggggattcgtttctcaggcggggaacggcagcgg
atcgcgcttgcccgtattctgctccaagacacgccggtcattatccttgatgaaccgacg
gtcggccttgatgcggtcactgaacgcgaattgcttgatacgatttttgatgtctttaaa
gagaaaacgatcctctggattacacaccatttagcgggtgtggaaacagctgataaaatc
gtctttttagaaaatggaaaagcagaaatggaaggaacccatcaagagctgcttgcagaa
aacgaacggtaccggaagctttaccgtcttgatgttccgatcagaacataa

DBGET integrated database retrieval system