KEGG   Bacillus amyloliquefaciens CC178: U471_03130Help
Entry
U471_03130        CDS       T02893                                 

Definition
(GenBank) nasB
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00910  Nitrogen metabolism
bamc01100  Metabolic pathways
bamc01120  Microbial metabolism in diverse environments
Module
bamc_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    U471_03130
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     U471_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD Pyr_redox Rubredoxin_C Pyr_redox_3 NIR_SIR NIR_SIR_ferr GIDA HI0933_like DAO NAD_binding_9 3HCDH_N AlaDh_PNT_C FAD_binding_2 NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGZ55029
LinkDB All DBs
Position
complement(326194..328521)
Genome map
AA seq 775 aa AA seqDB search
MKKQRLIAAGNGMAGIRCIEHILKMNRDMFEIVIFGSEPHPNYNRILLSSVLQGEVSLDD
ITLNSREWYEKNGITLYTGETVVDIDTERQVVTTDRKRSMTYDQIILATGSSPYILPIPG
ADKEGVYGFRTIEDCQSLINAASRYQKAAVIGAGLLGLEAAVGLRQLGMDVSVIHHSSAI
MQKQLDQTASRLLQKELERKGLVFLLEKGTASITGNSRAEGIRFKDSSSIEADLIVMAAG
VRPNIRLAPSAGLSVNRGIIVNQFMQTNKPNVYAVGECAEHDGIVYGLAPPLYEQGKVLA
QHLCGVPCEGFQGFAQSAALKIAGIDVWSAGKVHEDEHTAGILFHDEHAGIYKKALFEDD
KPAGFILFGDTRGKQRLLDSLVKQRDISIVKKQLMEPDQGGISFESMPPHETICQCSSVT
KGSIEEAVNKYGLKTAEEVKHMTKASGSCGGCRPLVEDLLKYMASDDYTKPSRQPSFCGC
TDLTEEEVIAEICRRPFTDAAEVMREIGWKTENGCRICIPALHYYLERTRPDFMQFNEIS
AEETCTLIPQMYGGLTSAAELKNIADVIEAYGIPGVSMTDSHRLRLSGIRPNDLASIRKA
LNMPVFSPRHRWTIQIRACTCGQHRSFQELASRIERDTDTLAVSAYVSVSLSCENNCTDA
YIQDIGAIQTQTGWEIYIGGFRGKQARAGSLFCVTDNEDSTAAMMKGLIQYYRETAHYNE
AIYQWVDRLGLVHIREMLFEEDMRTQLLKNLRSDISLLQNLSAGKTPYERMKLFD
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaacgattaattgcagcagggaacggaatggccggaatccgctgtattgaa
cacattttaaagatgaaccgtgacatgtttgagattgtcattttcggaagcgaacctcat
cccaattacaatcgcattctcttatcctccgttttacaaggtgaggtttcgcttgatgac
attacgctgaatagccgcgaatggtacgaaaaaaacggaattacgctttacacgggagaa
acggttgtagacattgatacagaacggcaggttgtcacaacggatcggaagcgcagcatg
acttacgatcaaatcatccttgcaacgggctcctctccttatattctccccatacccgga
gcagataaagaaggtgtgtacggctttcggacaatagaggactgccaatcccttatcaat
gcggccagccggtatcaaaaggcggcggtcatcggcgccggtttattaggtcttgaagcg
gccgtcggcttacggcagctcggcatggacgtcagcgtcattcaccactcttccgccatt
atgcaaaaacagcttgatcaaacggcatcccgcctgctgcagaaagagctggaacgaaaa
ggcttagtctttcttttagagaaaggcacggcatccattacagggaactcacgggcggaa
ggcattcgtttcaaagacagttcttccatagaagcagacctgattgtcatggccgccggt
gtgaggcccaatatccgattggctccatctgccggactttcagtgaacagaggaatcatc
gtcaatcaattcatgcagacgaacaaaccgaatgtgtatgccgtcggtgaatgcgcggag
catgacgggattgtatacggattggcgccgccgctttatgaacagggaaaagtgctcgcg
cagcatctatgcggcgtcccgtgcgaagggtttcaaggctttgcacaatctgcagcctta
aaaatagccggtattgatgtatggtcggcaggaaaggtgcacgaggatgagcacacagcc
ggcatattgttccatgatgagcatgcaggcatctacaaaaaagcgctctttgaggacgat
aaaccggccggctttattttattcggggacacgcgcggtaaacagcggcttctcgacagt
cttgtgaagcaaagagatatttccatcgtgaaaaaacagctcatggaaccggatcagggc
ggtatatcctttgaatccatgcctccccatgaaaccatttgccaatgcagctcagtgacc
aagggctccattgaagaagcggtgaacaaatatggcttaaaaaccgcggaggaagtgaag
cacatgacaaaagcgtccggatcttgcggaggatgcaggccgctcgttgaagacttgctg
aagtatatggcgagcgatgattacacaaaaccctcccgccagccttcgttttgcggctgc
accgatttgacagaggaagaagtcatcgccgaaatttgccgccgtccgttcactgatgcc
gccgaggtaatgagagagatcggctggaaaacagaaaacggctgccgcatttgtattccg
gcgcttcactattacttggaaaggacgcggcctgattttatgcagttcaatgaaatatcg
gcagaagagacatgcaccctgattccgcaaatgtacggcggactgacaagtgcggcagag
ctcaaaaacatcgcagacgtcatcgaagcatacggcatccccggggtttcgatgactgac
agtcaccggctgaggctttccggaatcaggccaaatgaccttgcaagcatcagaaaagca
ctgaacatgccggttttctccccccggcaccgctggacgattcaaatcagagcatgtacg
tgcggacagcatcgctcctttcaagagctggcaagcaggattgaacgagataccgacacg
cttgccgtctccgcttacgtatccgtcagcttgtcatgtgaaaacaattgcaccgatgct
tacattcaggatatcggcgcgattcagacacaaactggctgggagatttatatcgggggc
ttccgcggaaaacaagcccgcgccggcagccttttttgtgtgacggataacgaagacagt
accgccgctatgatgaaaggccttattcaatattatcgcgaaacggctcactacaacgaa
gcgatttatcaatgggttgacagactcggcctcgtccatatcagagaaatgctgtttgaa
gaagatatgcggacacagcttctgaaaaatctccgttcagacatatccctgctgcaaaac
ctgtctgccgggaaaacgccatacgaaaggatgaagctttttgactga

DBGET integrated database retrieval system