KEGG   Bacillus amyloliquefaciens CC178: U471_04730Help
Entry
U471_04730        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00473  D-Alanine metabolism
bamc01100  Metabolic pathways
bamc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    U471_04730
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    U471_04730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bamc01011]
    U471_04730
Enzymes [BR:bamc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     U471_04730
Peptidoglycan biosynthesis and degradation proteins [BR:bamc01011]
 Precursor biosynthesis
  Racemase
   U471_04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGZ55185
LinkDB All DBs
Position
487618..488787
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSATVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFDRFKTLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLGTINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatccttttacagagaaacgtgggcggaaatcaacctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttacggccacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcgatttcattgagaaaacggggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacggggtattctgttgaatggcttcaggaagctgcgcgccacctc
ggaagtgcgacagtgccgtttcatctgaaagtcgacaccggtatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcagccaaaatcccggtttagtc
tgtaaaggcgtattcacccattttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttgaccgctttaaaacattgatcgctccgcttcctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgccttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgctgacatccaaagcgaaattccgttt
caattaaagccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gttcccatcggctatgcggacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaacatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcactttgatcggcagccagaaggaagaaacg
atcacgatggatgaaatcgcggggcggcttgggacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaagcaagtag

DBGET integrated database retrieval system