KEGG   Bacillus amyloliquefaciens CC178: U471_09140Help
Entry
U471_09140        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bamc  Bacillus amyloliquefaciens CC178
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bamc02000]
    U471_09140
Transporters [BR:bamc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    U471_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA AAA_29 Rad17 AAA_22 G-alpha AAA_27 AAA_18 SbcCD_C AAA_15 AAA_33 ATPase_2 AAA_30
Motif
Other DBs
NCBI-ProteinID: AGZ55622
LinkDB All DBs
Position
907236..907952
Genome map
AA seq 238 aa AA seqDB search
MNLDFERVTKKYGRRLAVSDVSFSLSPGKIYGILGPNGSGKSTTLKMLAGLAFPTSGAVR
IGDCAVSRNMLFRTAYLTEHDMFSARTTVGDMLTFYHSQFPDFQLEKAHNLLTEMNLSAK
QKIKELSKGSRGRLKIVLALSRKASVILLDEPFSGLDPAVRESIVNSLVSYIDFDSQIVV
IATHEIGEIETLLDEVMVFIKGKIAERREVEEIREQEGMSVLQWYRSVMQAHEIEGGF
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgattttgaacgcgtaacaaaaaaatacggccgcaggctcgcggtcagcgat
gtatcattttcattgtctccgggtaaaatctacggaattttagggccgaacggaagcggt
aaatcaacaacgcttaaaatgcttgccgggcttgcgttcccgacctcgggcgccgtccgg
atcggagactgcgcagtaagcaggaacatgctgtttcgtacggcttatttaaccgaacat
gatatgttttccgcccggacgaccgtcggtgatatgctcacattttatcattcgcaattc
ccggattttcagctggaaaaagcacataacctattaacggaaatgaatctttcagcgaag
cagaagataaaagagctgtccaaaggcagccggggcaggctgaaaatcgttttggccctg
tcgagaaaagcatccgtcattctgctggatgagccgttttcaggtcttgatccggcggtc
agagaatcgattgtcaacagtctcgtatcttatattgattttgacagccagatcgtcgtc
atcgccacgcatgagatcggcgagatagagacgctgttagacgaagtgatggttttcata
aaagggaaaatcgctgaacggcgcgaggtcgaagaaattcgggaacaggaaggaatgtcc
gtgctgcaatggtacagaagcgtcatgcaggcgcacgaaatagaagggggattctaa

DBGET integrated database retrieval system