KEGG   Bacillus amyloliquefaciens CC178: U471_09380Help
Entry
U471_09380        CDS       T02893                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00564  Glycerophospholipid metabolism
bamc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    U471_09380
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     U471_09380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored Cation_ATPase_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGZ55644
LinkDB All DBs
Position
928991..930658
Genome map
AA seq 555 aa AA seqDB search
MMNHQFSSLERDHMLEDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFS
TSIGLRVYDYLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKVVGVLIEDLLSGKEYKVYAKKIVNATGPWVDELR
EKDHSKSGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KQKLEHPRMTVQDRDYVVSSINYMFPELNITADDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSQSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGGQDFGGCKTKTMPISGGHVGG
SKNFESFVEAKTKDGLKIGLSQETAKQLAIRYGSNVENVFSRIEGLKDEAEKRQIPVHIL
AEAAYSIEEEMAATPADFFVRRTGRLFFDIKWVQTYKTAVIDYMSDRFQWNDETKEKHTE
WLNTLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaccaattttcaagtttggaacgggatcatatgctggaagacatgactaaa
aaaacatacgatctgtttattatagggggaggtattacgggtgccggcacggcgcttgac
gctgcttcaaggggaatgaaagtcgctttgagcgaaatgcaggatttcgcggccggcaca
tcaagcagatccacaaagcttgtccacggcggtttgcgttatctgaagcaatttgaagtc
aaaatggttgcagaagtcggtaaggaacgtgccatcgtgtacgaaaacggcccgcacgtc
acgacgccggaatggatgctgctgccgtttcataaaggcggcacgttcggttcattctct
acttccatcggcctgcgtgtgtatgactatttagcgggagtaaaaaaatcagagcgcaga
agcatgctgtctgctaaagaaacgctgcaaaaagagccgctcgtcaaaaaagacggctta
aaaggcggaggctattatgtagaataccggacggacgatgcgagactgacgattgaagtc
atgaaagaagccgttaaattcggtgcggagcctgtcaactattctaaagtgaaagaactg
ctttatgaaaaaggaaaagttgtcggcgttttaattgaagatctgctgtcaggcaaggaa
tacaaagtttacgccaaaaaaatcgtcaatgcgacaggtccgtgggtcgacgagctgaga
gaaaaagaccacagcaaaagcggaaaacatcttcagcacacaaaaggggtccatctcgta
ttcgaccaatccgtattcccgcttaaacaggcggtgtactttgatacgccggacggccgg
atggtgttcgccattccgcgtgaaggaaaaacatacgtgggtacgaccgatacggtttac
aaacaaaaacttgagcacccgcgcatgacggtgcaggatcgcgattatgtcgtcagctcc
atcaattatatgttcccggaactgaacattacggcggacgatattgaatcaagctgggcc
ggcctcagaccgcttattcacgaagaagggaaagacccgtctgagatctcccgtaaagat
gaaatctggacatctcaatcaggcctgattacgatcgccggaggaaaactgacgggctac
cgtaaaatggctgagcacattgtcgatcttgtccgcgaccgcttgaaagaagagggcggc
caggacttcggcggctgcaagacgaagacgatgccgatttccggcggacatgtcggcggc
tctaaaaacttcgagtcatttgtggaagcaaagacaaaagacggcttgaaaatcggttta
tcacaggaaaccgctaagcagttagccatcagatacggctctaacgttgaaaatgtattc
agccggattgaaggtctgaaagacgaagcggaaaaacgccagattccggttcacattttg
gcggaagcggcttacagcatcgaagaagaaatggctgcgacacctgccgatttcttcgtc
cgcagaacgggaagactgttcttcgacatcaaatgggtgcaaacgtataaaacagccgtg
attgattacatgagcgaccgattccaatggaatgacgaaacgaaagaaaaacacactgag
tggttaaatacgctgctgcacgacgcggttgttccgctcgaacaataa

DBGET integrated database retrieval system