Bacillus amyloliquefaciens CC178: U471_22790 Help Entry U471_22790        CDS       T02893                                  Name (GenBank) dfnX   KO K02078   acyl carrier protein Organism bamc  Bacillus amyloliquefaciens CC178 Pathway bamc00998   Biosynthesis of various antibiotics bamc01100   Metabolic pathways bamc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U471_22790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U471_22790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1280 Motif Other DBs NCBI-ProteinID:  AGZ56977 LinkDB All DBs Position complement(2339765..2340037) Genome browser AA seq 90 aa AA seqDB search MEQTKEMKQIIAQIIQDIQEQQSYRAVEAGDDVRVIEDLGFSSLDIAQLVAQMEMETGVD PFSQGETISSITTVGSICDIYQKYMDSAQS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaacaaaccaaggaaatgaagcagatcatcgctcaaatcattcaggatattcaagaa cagcagtcatatcgggccgtcgaagcgggggatgatgtgagagtcatagaggatctgggc ttctcatcattggatatcgctcaattagtcgcacagatggagatggaaaccggagtagat cctttttcccaaggagaaacaatttccagcattacaaccgtcggcagcatttgtgatatt tatcaaaaatatatggacagtgctcaatcatga

DBGET integrated database retrieval system