KEGG   Bacillus amyloliquefaciens CC178: U471_26470Help
Entry
U471_26470        CDS       T02893                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00020  Citrate cycle (TCA cycle)
bamc00190  Oxidative phosphorylation
bamc00650  Butanoate metabolism
bamc01100  Metabolic pathways
bamc01110  Biosynthesis of secondary metabolites
bamc01120  Microbial metabolism in diverse environments
bamc01130  Biosynthesis of antibiotics
bamc01200  Carbon metabolism
Module
bamc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    U471_26470
   00650 Butanoate metabolism
    U471_26470
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    U471_26470
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     U471_26470
    1.3.5.4  fumarate reductase (quinol)
     U471_26470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_2 Fer4 Fer4_16 Fer4_15 Fer4_4 Fer4_13 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AGZ57345
LinkDB All DBs
Position
complement(2666062..2666820)
Genome map
AA seq 252 aa AA seqDB search
MSEKKIRFIITRQDTPESAPYDEEFEINYRPNLNVISALMEIRRNPVNAKGEKTTPVAWD
MNCLEEVCGACSMVINGRPRQSCTALIDKLEQPIRLKPMKTFPVVRDLQVDRSRMFDSLK
KVKAWVPIDGTYDLGPGPRMPEKRRQWAYELSKCMTCGVCLEACPNVNSKSKFMGPAPMS
QVRLFNAHPTGAMNKAERLEALMTDGGLGDCGNSQNCVQSCPKGIPLTTSIAALNRDTNL
QAFRNFFGSDRV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaaagatacggtttatcattacacgtcaggatacgcccgaaagcgcgcca
tacgatgaagaattcgaaatcaattaccgcccgaacctgaacgtgatttccgccctgatg
gaaatccgcagaaatcccgtgaatgcaaaaggagagaaaaccactccggtcgcatgggac
atgaactgtcttgaagaagtatgcggcgcctgctccatggtcatcaacggaagaccgcgc
cagtcatgtacggcgctgattgataagctggaacagccgatccgtctgaagccgatgaaa
acattcccggttgtccgtgaccttcaggttgaccgcagcagaatgtttgattcactgaaa
aaagtgaaagcatgggtgccgattgacggaacttacgatttggggccggggccgagaatg
ccggaaaaacgccgccagtgggcatatgaattgtctaaatgcatgacatgcggcgtctgc
ctcgaagcctgcccgaacgtcaacagcaagtcgaaattcatggggcctgccccgatgtcg
caagttcgtctgtttaacgcccatccgacgggtgcgatgaacaaagcagaacgtttagaa
gcgttaatgacagacggcggcctcggagattgcgggaattcacaaaactgtgttcaatcc
tgcccgaaaggcattccgcttacgacttcaatcgccgctttgaacagagataccaattta
caagcattccgtaatttcttcggaagcgacagagtataa

DBGET integrated database retrieval system