KEGG   Bacillus amyloliquefaciens CC178: U471_30050Help
Entry
U471_30050        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
Organism
bamc  Bacillus amyloliquefaciens CC178
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2278 Ole-e-6 CW_binding_1
Motif
Other DBs
NCBI-ProteinID: AGZ57703
LinkDB All DBs
Position
3017215..3017892
Genome map
AA seq 225 aa AA seqDB search
MAVQHYGVLKGTVSDMRRETDDDSPHFQVEVLGEPDTRYRCAINVMSSSKESEVLYAARD
HFDASAITLLPNIPYGYTPIDETSRELALDYVRDGLFDPRNMVPLPHEVTGPDNDLNDFI
ETYMQKAKSEKATVYIYGSKFGPEPGADKIFGFKPTNGMHNIHMNQGNPIDTRWKKDNGT
WHDGGILIQFADQWAAVFLAFLSQSWCTNEEGHPYTFCDHTQLNG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcagcactatggtgtattaaaaggcactgtgtcagatatgagaagggaaaca
gatgatgattctccgcattttcaagtcgaggtgctaggcgagcctgatacgcgctatcgc
tgtgcgatcaatgtcatgtcaagttcaaaagaatcagaggttctgtatgcggcacgcgat
cattttgacgcaagcgcgatcaccctgctgcccaacattccgtatggatataccccaatt
gatgaaaccagccgtgagctggcgctggattatgtccgcgacggattgtttgatccccgg
aacatggtgcccctcccgcatgaagtcaccggtccggataatgacttaaatgactttatt
gagacgtacatgcaaaaagccaaatcagaaaaagccaccgtctatatttacggctctaaa
ttcgggccggagccgggcgctgataagattttcgggttcaagccgacaaacggcatgcat
aatattcatatgaatcagggaaacccaattgatacacgctggaagaaggataacggaacg
tggcacgacggaggtattttaatccagtttgcagaccagtgggccgcggtctttttggct
tttctgtctcagtcatggtgcacgaatgaagaaggccacccttatacattttgtgatcat
acacagcttaacggctga

DBGET integrated database retrieval system