KEGG   Bacillus amyloliquefaciens CC178: U471_31020Help
Entry
U471_31020        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00071  Fatty acid degradation
bamc00362  Benzoate degradation
bamc00650  Butanoate metabolism
bamc01100  Metabolic pathways
bamc01120  Microbial metabolism in diverse environments
bamc01200  Carbon metabolism
bamc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    U471_31020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U471_31020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U471_31020
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     U471_31020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AGZ57800
LinkDB All DBs
Position
complement(3105627..3107996)
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALIYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERLEEEGA
ALPGWVKEMLDQGHETFYMKENGTPFYYSDGQYRAVKENPKRISLQTLKETKGVITKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETERNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLDGGSELMDAAIKTFETIALAKVSGSAHEARD
MKILSAADRISMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcaga
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataacggcggggaatttggaagatgacgcagctcaattgaaggat
gctgattggattattgaagtcgtcgtcgaaaatcttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcatcgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgatctgccgattttaaagctcatttcttaggaacccat
ttctttaatccggcccgctacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgctcgggaaaggggtcgtc
atcgcaaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgaccggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
actttcgcccatgtggcaaaaaatgtgtatgataaagccgacggcgctgaaaaagacatg
tttaagcttcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgatccgctgaccatg
acatacggtgagcgctcgaaaatgaagacacccgctttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttatatactctgatgaccgcgccgggcgcctgctt
tggaatattacatcgcaaacactcttatactcagcccggcttttaggtgagatcgctgat
gatatcaaagcaattgatgacgccatgaaatggggcttcggatgggagctcggaccgttt
gagatgtgggatgccatcggcgtcagaaaatcagcggagcggctcgaagaagaaggcgca
gcactccccggctgggtgaaagaaatgcttgatcagggccatgaaacattttatatgaag
gaaaacggaacaccattttactattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcaaacgttaaaagaaacaaaaggcgttatcactaaaaacagcgga
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaacggagcggaat
tataaaggtcttgtcatcggtaaccaaggcagacatttctgcgcgggggcaaaccttgcg
atgattttgatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtcgcggcgccattc
gggatgacactcggcggcggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtcttgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttggacggcggaagtgaactgatggacgcagcgatt
aaaaccttcgaaacaatcgcgcttgccaaagtgtccggttcggcacacgaagcccgtgat
atgaagattttgtccgcggcagaccgtatcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgcccgcctgcccgcaaaaaa
gtgaaagtcaccggggaaaccggatgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcacggaggtttcagaagaatatttacttgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system