KEGG   Bacillus amyloliquefaciens CC178: U471_31100Help
Entry
U471_31100        CDS       T02893                                 

Definition
(GenBank) hypothetical protein
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00061  Fatty acid biosynthesis
bamc00780  Biotin metabolism
bamc01100  Metabolic pathways
bamc01130  Biosynthesis of antibiotics
bamc01212  Fatty acid metabolism
Module
bamc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    U471_31100
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U471_31100
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    U471_31100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bamc01004]
    U471_31100
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     U471_31100
Lipid biosynthesis proteins [BR:bamc01004]
 Fatty acid synthase
  Component type
   U471_31100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR LDcluster4 THF_DHG_CYH_C Epimerase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AGZ57808
LinkDB All DBs
Position
complement(3112606..3113346)
Genome map
AA seq 246 aa AA seqDB search
MNLQHKTALVTGGGTGIGRAACLALAKRGAAVVINYSHSKTEAEQTAEIIIKAGGHAMTI
QADVSIDKQARDMVNEAASRFGSLDLLVNNASITRHIPLHDLESATKEVWDELFAVNVNG
MFHCARAAASHMKKQKSGAIVNVGSIAGLTGAGSSLPYAVSKAAVHGLTKSLAHALAPDI
RVCCVAPGAVATRWWTGREETMYRLAGSLPLERIAAPEDIGELICSVLEQESLTGQIITA
DCGQTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaacataaaacggcactggtcacaggcggcggtacaggaatcggaagagcg
gcgtgccttgccttagcaaaacggggagcggctgttgtcattaactattcacattcaaaa
acggaagcggaacaaacggcagaaatcataataaaagcaggcggacacgcgatgaccatt
caagcggacgtttctatagacaaacaggcgagagacatggtgaacgaagcggccagccga
ttcggaagccttgatttactcgtaaataatgcgagcatcaccagacatattccgcttcat
gatttggaatctgcaacgaaagaagtatgggatgaattatttgctgtcaatgtaaacggg
atgtttcattgcgcaagagcggcagcgtctcatatgaaaaagcaaaagtcaggcgctatt
gtgaatgtcgggagcatcgccggcctgacgggagcgggttcttcccttccgtatgccgtt
tccaaagcggcggtgcatggcctgacaaaatcattggcccatgcgctggcgccggacatc
cgtgtatgctgtgtcgcgcccggagccgttgcaacaagatggtggacgggtcgggaagag
acgatgtatcggcttgccggaagccttccgctggaacggatcgctgctccggaggatatc
ggtgaactgatttgctctgtgctggagcaggaatcactgacgggacaaatcataacagcc
gattgcggccagacgatgtga

DBGET integrated database retrieval system