KEGG   Bacillus amyloliquefaciens CC178: U471_34300Help
Entry
U471_34300        CDS       T02893                                 

Definition
(GenBank) pgdS
Organism
bamc  Bacillus amyloliquefaciens CC178
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 Peptidase_C92 LRAT DUF1175 Amidase_5 TGT_C1
Motif
Other DBs
NCBI-ProteinID: AGZ58128
LinkDB All DBs
Position
complement(3421560..3422795)
Genome map
AA seq 411 aa AA seqDB search
MLTSWRKYILAGLMICLVAPAVTRTEIAEADSQVSVLMVSDAQKLVGNKYVYGGEEPEDG
FDPSGLIHYLFSRQNIHLPRTVSDQWKVGTAVKENDLLPGDLVFFKKSDSTQNAPVHDGL
YIGNGEMIHSSPSEGVTVTRFQKSSYWMNLYLGAKRITKDPELADDPIVQEAARYLDIPY
VFGGSTPEEGFDCSGLVQYVFENKLHIYLPRSAEQQWLVGEKIKLSGIKPGDVIYFSDTY
KKGISHAGIYAGEGRFIQASRSAKVTISYLSEDYWKKHFTGVRRFSNLAISKENPVVSTA
ADHIGISYLKGGVSPETGFDTAGFVQYVYQKAKGISLPRYADKQMQAGVPVDKQDLKPGD
LVFFKAESLNPAIYIGNGQVIHVTVSAGVTITNMNTSAYWKDKYAGGIRLP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgctcacaagctggaggaagtacatccttgccggccttatgatttgtcttgtggcaccc
gcagtaacgagaacggaaattgctgaagcggattctcaagtttctgtcctgatggtttca
gacgcgcaaaaacttgtcggaaataaatatgtttacggaggcgaagagcctgaggacggt
tttgatccgtccggattgattcattatcttttcagcagacagaacatccatctgccgaga
acggtcagtgatcaatggaaggttggaaccgccgtcaaagaaaatgaccttttaccggga
gatcttgtgtttttcaaaaagtcagattcaacacaaaacgcacccgtccatgacggtctt
tatatcggaaacggagagatgatacacagttctccgtcagaaggcgtaaccgtcacacgg
tttcaaaaaagcagttattggatgaatttatatcttggcgcaaagcggattacaaaagat
ccggaactggctgatgacccgatcgttcaggaggcagcccgttacctcgacattccgtat
gtattcggcggaagcacgcctgaggagggattcgactgttcagggctggtccaatatgtt
tttgaaaacaagcttcacatttacctgccgagatctgcggaacagcagtggctggtcggt
gagaaaatcaaactgagcggcataaagcccggggacgtgatttatttcagcgacacgtat
aaaaaaggaatttcccatgcgggcatttatgcgggagagggaaggttcatccaagcaagc
cgctccgcaaaagtcaccatttcttacttgtcggaagattactggaaaaaacattttacg
ggggtgcgccgattcagcaatttagccatttctaaagaaaatcccgttgtgtccacagcg
gccgatcatatcggaatttcttatctgaaaggcggcgtttcaccggaaaccggctttgat
acggcgggatttgttcaatacgtctatcaaaaagcgaaaggaatcagcctgccgcgttat
gcggacaagcagatgcaggcgggcgttccggtcgataaacaggatctgaagcccggcgat
ctggtcttctttaaagcggaaagcctgaatccggccatttatatcgggaacggacaagtg
attcatgtcaccgtgtccgcaggcgttaccataacaaatatgaacacaagcgcttattgg
aaggacaaatatgcgggcggcatccggcttccgtaa

DBGET integrated database retrieval system