KEGG   Bacillus amyloliquefaciens LFB112: U722_00435Help
Entry
U722_00435        CDS       T02965                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
bamf  Bacillus amyloliquefaciens LFB112
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bamf03110]
    U722_00435
Chaperones and folding catalysts [BR:bamf03110]
 Heat shock proteins
  HSP33
   U722_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AHC40682
LinkDB All DBs
Position
80989..81864
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLILGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggtaaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcgtctctgatactcggagcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtatcaaatccgcacgttcattttgacctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgacggaacactcagtgtcgtaaaa
gatttgggcttgcgtgattattttacggggcaagtagagattgtctcgggtgaactcggt
gatgacttcacgtattaccttgtttcttctgaacaagtcccttcatctgtcggggtaggt
gttctagtaaatcctgataacacgattctcgctgcgggcgggttcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgaaaagcaattatctcaaatcgaaccg
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttagaagaagttctgggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaaatatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system