KEGG   Bacillus amyloliquefaciens LFB112: U722_01790
Entry
U722_01790        CDS       T02965                                 

Definition
(GenBank) ferredoxin--NADP reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U722_01790
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     U722_01790
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     U722_01790
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like DAO Thi4 FAD_oxidored NAD_binding_8 FAD_binding_3 Amino_oxidase NAD_binding_7 FMO-like K_oxygenase
Other DBs
NCBI-ProteinID: AHC40907
LinkDB
Position
350834..351844
AA seq 336 aa
MAENHEVYDVTIIGGGPIGLFAAFYCGMRELKTKVIEFLPRLGGKVSMFFPEKIIRDIGG
IPGIAGEQLIKQLKEQAATFEPDIVLNQRVAGFERLEDGTIVLESSEGEKHYTRTVILAV
GMGTLEVNELDSADASRYSGKNLHYKVEKLDAFRDKHVVISGGGDTAVDWANELEPIAAS
VTVLHRREEFGGLESSVAKMKRSSVRVLAPYRLKHLNGTGERIESVTVCQTESGLSEVIK
LDELIINHGFKIDLGPMKDWGLEIEEGRIKADRHMRTNLPGVFVAGDAAHYESKLRLIAG
GFTEGPTAVNSAKAYLDPQADQMAMYSTHHKKLVTQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggcggaaaatcatgaggtgtacgacgtcacgattataggcggaggcccgatcggcctg
tttgcggctttttattgcgggatgcgggagctgaaaacgaaagtgatcgagtttttgccg
cggctcgggggaaaggtgtctatgttttttcctgaaaaaatcatccgtgatatcggcgga
atacccgggattgccggggaacagctgattaagcagctgaaggagcaggcggcgacattt
gagccggatatcgtgttgaatcagcgggtggccggatttgaacggctggaagacggaacc
attgtgctggaaagttccgaaggggaaaagcactatacgcgcacggtgattttggccgtc
ggcatggggacgcttgaggtcaatgaacttgacagcgcggatgcgagccgttattcagga
aagaaccttcattataaggtggagaagcttgatgcgtttcgagataagcatgtcgtgatt
tccggagggggagataccgcggttgactgggcgaatgagctggaaccgattgcggcgtct
gttaccgtcttgcaccgccgtgaggagtttggcggtttggaaagcagcgtggcgaaaatg
aagcggtcttccgtgcgggtgcttgcgccgtatcgtctgaagcatctcaacggcaccggg
gaacggatcgagagcgtcaccgtttgccaaactgagtccggactttctgaagtcatcaag
cttgatgagctcattatcaaccacgggtttaaaattgatctcggtccgatgaaggactgg
gggcttgagatagaagaaggcaggattaaagctgacaggcatatgcgcacgaatcttccg
ggcgtgtttgtcgccggtgacgccgcccattatgaaagcaagctcagactgattgccggc
ggtttcacggagggcccgaccgcagtgaacagcgccaaagcctatttggacccgcaggcg
gatcagatggcgatgtattcgactcatcataaaaaattggtgacacaataa

DBGET integrated database retrieval system