KEGG   Bacillus amyloliquefaciens LFB112: U722_01805
Entry
U722_01805        CDS       T02965                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00910  Nitrogen metabolism
bamf01100  Metabolic pathways
bamf01120  Microbial metabolism in diverse environments
Module
bamf_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    U722_01805
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     U722_01805
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 NAD_binding_9 AlaDh_PNT_C GIDA NAD_binding_7 3HCDH_N FAD_binding_2
Other DBs
NCBI-ProteinID: AHC40910
LinkDB
Position
complement(353746..356163)
AA seq 805 aa
MGKKQLVLVGNGMAGVRAIEEILRVSKDEFEITIFGAEPHPNYNRILLSKVLQGDTDIQD
ITLNDWNWYKENNIQLYTGETVIKVDTENQTVITDADRIQPYDELILATGSVPFILPIPG
ADKQGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDAAAGRLLQNELEKQGMTFFLEKQTEEILGTDRVEGVRFKDGTSIKADLVVMAVG
IRPNTQLGTESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHICGIETKPYEGSVLSTQLKVSGVEVFSAGDFDESEDKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLDQEAGASMTAAMSDDEIICGC
NGVSKGAIIQAIQEKGCTSTDEIKACTGASRSCGGCKPLVEDILQYTLGSEFDSSAQKEA
ICGCTSLSRDEVVEEIKAKGLSHTREIMNVLGWKTPEGCSKCRPALNYYLGMINPAAYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSQDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWAELDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPEKRQELNDRMNETLSVH
KDPWQYFLKDKKASKDLFENVVTTS
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgggaaaaaaacagctagtccttgttggaaatggaatggccggggtaagagcgattgaa
gaaatactgcgtgtttcaaaagacgaatttgagattacaatattcggggccgaacctcat
cccaactataaccgaatccttctgtcaaaagtgctgcaaggcgataccgacattcaagac
attacgttaaacgattggaactggtacaaagaaaacaacattcagctgtataccggtgaa
acagtcatcaaagtcgacacggaaaaccaaaccgtcatcaccgatgcagacagaatccag
ccttacgatgaactcatcctggcgacaggctctgtcccttttatccttccgattccgggc
gcagacaaacaaggcgtcacggcattccgagacataaaagataccgacacgatgctcgcc
gcgtcaaaacaatataaaaaagcagccgtcatcggcggaggactgctgggtttggaagcc
gcgcgcggactgctgaatctcggcatggacgtgtctgtcatccacctcgccccattcctg
atggagcgccagcttgacgcagcggcgggacgcctgctgcaaaacgagttagaaaaacaa
ggcatgacctttttccttgaaaaacaaaccgaagaaattctcggtactgaccgtgtcgaa
ggcgtacgctttaaagacggcacaagcatcaaagctgatctggtcgtcatggcggtcggc
atccgcccgaatacacagcttggcacagaaagcggcatcccggtaaaccgcggaatcatt
gtcaacgattatatgcagactgaaattccgcacatttacgcggtcggtgaatgtgccgag
caccgcggaatcgcatacggtcttgtggcgccgctctatgaacaggcaaaagtgctggcc
aaacatatttgcggcattgaaacaaaaccgtacgaaggctccgttctctccactcaatta
aaggtatcaggcgtcgaggtcttctctgccggcgactttgatgaatcagaggacaaaaag
gcaataaaagtgttcgatgaacaggacggcatttataaaaaaatcgtcctgaggggcaat
caaattgtcggcgctgttttgttcggagacagcagcgaaggcaaccgcctgttttctatg
attcaaaaagaagcagatatctctgaaacctccaaaatatcaatcttacagcctcttgat
caggaagcaggcgcaagcatgaccgcggcgatgagcgacgatgaaatcatctgcggctgc
aacggcgtttcaaaaggtgcgattattcaagccattcaggaaaaaggctgcacatcaacg
gacgaaatcaaagcatgcaccggggcatcccgttcctgcggaggctgtaaaccgctcgta
gaagacattcttcaatatacactgggctcagaatttgactcatccgcgcaaaaagaagcg
atttgcggctgcacctcactgtcgagagatgaagtcgtagaagaaatcaaagccaaaggg
ctctcacatacaagagaaatcatgaacgtgctcggctggaaaacgccggaaggctgctcc
aaatgccggcctgccctcaactactacttaggcatgattaatccggctgcatacgaggat
gacagaacatcccgttttgtgaacgaacggatgcacgccaatattcaaaaagacggaaca
tactcagtcgttccccggatgtacgggggcgtaaccaactctcaagatctccgcaagatc
gccgatgtcgtcgacaaatatgagatcccgctcgttaaaatgaccggcggccaacgaatt
gatctcatcggcgttaaaaaagaagatctgccgaaagtatgggccgagcttgatatgccg
tcaggctacgcgtacggaaaaacactccgcacggtaaaaacgtgcgtaggcgaacaattc
tgccgcttcggcacacaagactccatggcactgggtattgcgcttgagaaaaaattcgaa
gggctcaatacgcctcataaggttaaaatggccgtgtccgcctgcccgcggaactgtgcg
gaatcaggcattaaggaccttggcgttgtcggcatcgacggaggctgggagctttatgtc
ggcggaaacggcggaacccatttgcgcgccggtgatttgctgatgaaagtaaaaacgaat
gaagaagtcttagaatacgcgggtgcttaccttcagtactacagagaaacggcaaactat
ctggagcggacatccgcatggcttgagcgcgtcggtttatctcatgtccaatccgtatta
aacgatccggaaaaacggcaggagctcaacgacagaatgaatgagacactctctgtccac
aaagatccgtggcaatacttccttaaagataaaaaagcttctaaagatctattcgaaaat
gtcgtcacgacttcataa

DBGET integrated database retrieval system