KEGG   Bacillus amyloliquefaciens LFB112: U722_02025Help
Entry
U722_02025        CDS       T02965                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bamf  Bacillus amyloliquefaciens LFB112
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bamf02022]
    U722_02025
Two-component system [BR:bamf02022]
 OmpR family
  Unclassified
   U722_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg GerE DUF3490
Motif
Other DBs
NCBI-ProteinID: AHC40949
LinkDB All DBs
Position
416298..416981
Genome map
AA seq 227 aa AA seqDB search
MKILMIEDNISVCTMTEMFFFKEGFEAEFVHDGVEGYQRFTEEDWDLVILDIMLPSMDGV
TICRKIRETSSVPIIMLTAKDTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYRA
TGQAVKSGDLIETACFSINKKTREVFLHGKPVENLTPKEFDLLFYLAQNPRQVFSREQLL
EQVWGYQFYGDERTVDVHIKRLRKKLSSEEKPFLYTVWGVGYKFDED
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattaatgatagaagacaatataagcgtatgcaccatgacggaaatgttcttt
tttaaagaaggatttgaagccgaatttgtccatgacggagtggaaggctatcagcggttc
acggaagaggactgggatttggtcattctggatattatgcttccatctatggacggagtg
acgatctgccggaaaataagagagacgagcagtgtgccgattattatgctgaccgcaaag
gacacggagtctgatcaggtgatcgggtttgaaatgggagccgacgactatgtcaccaag
ccgttcagcccgctgacgctagtagcgcggattaaagcggtgatcagaagataccgggcg
acggggcaggccgtaaaaagcggcgacttgatcgaaacggcgtgtttttcaatcaataag
aagacgcgggaagtgtttctgcatggaaagcctgtcgagaatctgacgccgaaggaattc
gatctgctcttttatctcgcacaaaatccgcgccaggtcttttcgagagagcagctgctt
gagcaggtgtggggctatcaattttacggcgatgaacgtacggttgatgttcatattaaa
cggctgcgcaaaaaactgtccagtgaggaaaaaccgtttttatacacggtgtggggggta
ggatacaaatttgatgaggattaa

DBGET integrated database retrieval system