KEGG   Bacillus amyloliquefaciens LFB112: U722_02080Help
Entry
U722_02080        CDS       T02965                                 

Definition
(GenBank) TetR family transcriptional regulator
Organism
bamf  Bacillus amyloliquefaciens LFB112
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 HTH_6 UPF0122 HTH_7 DUF123 Pox_M2
Motif
Other DBs
NCBI-ProteinID: AHC40960
LinkDB All DBs
Position
complement(427013..427888)
Genome map
AA seq 291 aa AA seqDB search
MNDKKTDILLAARKLFSGKSFSSVSMQAIAEECKVSKASLYKLFESKEDLLLELLDFNQK
QMVAAASLLNEETSLSPEERFSKKLMAELEGFRRNQQFFNMLMYGSPSSINERVKRHIHR
ARSTFICWHRDSLIQTYGEDIIPYVWELVIVLQGLLRECITLIKLEKEPLALEPLTDFII
RHLNLIVENRKTETALPQEMIDLYTASASSFEPKDKTVLLAESLKELKEAVSALPEEKYD
AAGLASAAVMLEKESADKQPRDFLIKALIGYLEQAGPLHQPLAAVKTLLKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataagaaaacggatattctgctggcggcaaggaagcttttttccgggaaaagc
ttttcgtcggtctcgatgcaggcgatcgcagaggagtgcaaagtctccaaagcatctttg
tataagctgtttgaatcaaaggaagacctgctcctggagctgctcgattttaaccagaaa
cagatggtagcggccgcttcattattaaatgaagaaacgagcctctcccctgaggaacgg
ttttccaaaaaactgatggctgagcttgaaggcttcaggcgcaaccagcagttttttaat
atgctgatgtacggaagcccctcttccattaatgagcgggtaaaacggcatattcacagg
gcccgctccacctttatctgctggcatcgcgattcactgattcagacgtacggcgaagac
attattccttatgtatgggagctggtgatcgtcctgcaggggctcctgagagaatgcatc
acgctgattaagctggaaaaagaaccgctcgccctggagccgctcacggactttatcatc
cgccatctcaatctcatcgtcgaaaacaggaaaaccgaaaccgctttgcctcaggagatg
attgacctttataccgcctccgcttcctcatttgagccgaaagacaaaaccgtattgctg
gctgaaagcctgaaggaactgaaagaagccgtctcagcccttccggaggaaaaatatgat
gccgcaggactcgcttccgcggcggttatgctggagaaagaatcagcggacaaacagccg
cgggattttcttataaaagcgctcatcggttatttggagcaggccggaccgctgcaccag
ccgcttgcagccgttaaaacattgctcaaactataa

DBGET integrated database retrieval system