KEGG   Bacillus amyloliquefaciens LFB112: U722_02515Help
Entry
U722_02515        CDS       T02965                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00473  D-Alanine metabolism
bamf01100  Metabolic pathways
bamf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    U722_02515
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    U722_02515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bamf01011]
    U722_02515
Enzymes [BR:bamf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     U722_02515
Peptidoglycan biosynthesis and degradation proteins [BR:bamf01011]
 Precursor biosynthesis
  Racemase
   U722_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHC41047
LinkDB All DBs
Position
506434..507603
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GGATLPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFDRFKTLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLETINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatccttttacagagaaacgtgggcggaaatcaacctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttacggccacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcgatttcattgagaaaacggggcatt
acagcgccgattcttgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacgggatattctgttgaatggcttcaggaagctgcgcgccacctc
ggaggtgccacattgccgtttcatctgaaagtcgataccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcagccaaaatcccggtttagtc
tgtaaaggcgttttcacccactttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttgaccgctttaaaacattgatcgctccgctccctttaaaagaattgatggtg
cactgcgcgaacagcgccgccggacttcgccttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgctgacatccaaagcgaaattccgttt
caattaaagccggcttttgcgctgcactctgtgttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatataccgcagagaaggatcaatggatcggaacg
gttcccatcggctatgcagacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaacatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagaaacg
atcacgatggatgaaatcgcagggcggcttgagacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaaacaagtag

DBGET integrated database retrieval system