KEGG   Bacillus amyloliquefaciens LFB112: U722_03240Help
Entry
U722_03240        CDS       T02965                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00040  Pentose and glucuronate interconversions
bamf00051  Fructose and mannose metabolism
bamf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    U722_03240
   00051 Fructose and mannose metabolism
    U722_03240
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     U722_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AHC41168
LinkDB All DBs
Position
629170..630231
Genome map
AA seq 353 aa AA seqDB search
MTHTVPQNMKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNY
VVEKPFILGHECAGEIAAVGSSVDQFKIGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFL
ATPPVDGAFVQYIKMRQDFVFSIPDSLSYEDAALIEPFSVGIHAAARTKLQPGSTVAIMG
MGPVGLMAVAAAKAYGAGTIIVTDLEPLRLDAAKKMGATHVINVREQDAGEEIKTITNGR
GVDAAWETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIFRYA
NTYPKGIEFLASGIVDTKHLVTDQYPLEKTQEAMERAFQYKNECLKVMVYPNR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactcacacagtgcctcaaaacatgaaagcggcggttatgcacaacacgagagaaatc
aaaatcgaaacattgcccgtgcctgacatcaatcatgatgaagtgttgattaaggtgatg
gctgtcggaatttgcggatctgatctgcattactatacaaatggcagaataggcaattat
gtagtggaaaaaccatttatcctcggtcatgaatgcgcgggagaaattgccgccgtcgga
tcgtctgtcgatcaatttaaaataggagaccgggtcgccgtcgaacccggtgtcacatgc
gggcgctgtgaagcgtgcaaagaagggcgttataatctttgcccggatgtacagtttttg
gcgacaccgccggttgacggcgcgtttgtccaatatatcaaaatgcgtcaggactttgtt
ttttcgattccggattcactttcctatgaagatgcggctttgatcgaaccgttttctgtc
ggcattcatgcggccgcgagaacgaagcttcagcccggttcaacggttgcgatcatggga
atgggtcctgtggggctgatggccgttgcggcagcgaaagcatacggggcaggcacaatc
attgtgaccgacttggagccgctgcggttagatgccgcgaaaaaaatgggcgcgacgcat
gtcatcaatgtccgggaacaggatgccggtgaagaaatcaaaacgatcacgaatggcaga
ggcgttgatgctgcctgggaaacagcggggaatccggcggcattgcaatccgcactggcg
tccgtgcgccggggcggaaaactggcgattgtcggtttgccttctcagaacgagatcccg
ctcaatgtgccgtttattgcggataacgagattgatatatacggaatcttccgttatgcg
aatacgtatccgaagggaattgaatttctcgcttccggcatagtggacacgaagcatctt
gtaacggaccaatatccgctggagaagacgcaagaggcgatggaacgcgcctttcaatac
aaaaatgaatgcttaaaagtgatggtgtatccaaatcgctga

DBGET integrated database retrieval system