KEGG   Bacillus amyloliquefaciens LFB112: U722_03730Help
Entry
U722_03730        CDS       T02965                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00627  Aminobenzoate degradation
bamf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    U722_03730
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     U722_03730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHC41263
LinkDB All DBs
Position
730877..732334
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFRKATPDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVAGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVEKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatgggagc
agccggaacgtattggaaaacagaaatccttatactcaaaaagtcatcacctcattccga
aaagcgacgcctgatgacgtggatgcggcatatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagccgtttctttcatt
gaagagcacgaagaagcgattatttacttaatcatggaggagctaggcggaacacggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgacggaaaagaaaacaggctgtac
agaatacctgccggagtcgcgggggtaatcagcccgtttaatttcccgtttttcctttcg
atgaaatctgttgcgccggcactcggcgcggggaacggcgtcgtgctgaagcctcatgaa
gaaacgccgatctgcggcggaacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaatgtcatcgtgacggatatcggggagatcggcgacagctttgttgag
catcccgtgccacggataatctcatttacaggctcaaccggagtgggcagctatatcgga
cagcttgcggtcaaacactttaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggatgctgatcttgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcaaggccagatctgtatgtcggcgaaccgcgtgctcgttcacacatctgtttat
gacaaatttacagagctctacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcggtcctttaatcaatgagagacaggcggaaggcctgagacgg
tctgtcgaaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcctgtcattttaaaagatgtgaaacctgagatgagcatcgcgaaggag
gagctgttcggaccggccgtctgcatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgtggagcgg
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgaccatt
aatgatgaaccgaacgttgcgttcggcggcgagaaacaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cgccaattcccatattaa

DBGET integrated database retrieval system