KEGG   Bacillus amyloliquefaciens LFB112: U722_08280Help
Entry
U722_08280        CDS       T02965                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bamf01001]
    U722_08280
Enzymes [BR:bamf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     U722_08280
Protein kinases [BR:bamf01001]
 Serine/threonine kinases: Other
  Bacterial family
   U722_08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Seadorna_VP7 Pkinase_fungal Trp_oprn_chp FixH PBP_N
Motif
Other DBs
NCBI-ProteinID: AHC42106
LinkDB All DBs
Position
1610352..1612295
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDIDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYITAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAASQAETPGETDDKEQQPAKKKKRKWPWVLLAVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDEKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDSEAGTVIEQDPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPEGQVMKQEPS
AGTAVKPGSNVEVTFSLGPEEKPAKTLKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcccattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacattgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtcagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
accgcacacggaccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcaccgggatattaaaccgcacaatata
ttgatagatcatttagggcatatcaaggtgacggatttcggcatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggcctggcaacgaaaaaatcagatatttacgcgctcggcatcgtgctg
tttgagcttttaacaggcaaaatcccttttgacggagaatcagccgtcagcatagcgcta
aagcacctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gttgaaaacattattttaaaggcaaccgccaaagacccgtttcaccgctatgaaagcgcg
gaggacatggaggcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgtgcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgtctcaggcggaaacgccgggggagacggatgataaggaacagcagccagcc
aaaaagaaaaaacggaaatggccgtgggttttgctggccgtctgtttcattttcattatg
gcggctgttcttgcggtcaccgtgttcccgtctttatttatgcctaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgcttgaaaagaacgggctc
cgggctgatcctgatataacggatattgaagatgaaaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaaggacggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggtttcaaacatgtcaatgtcaaagaagaaaacgatgac
agcgaggccggcaccgtaattgagcaggacccgtcagccggcaccgatatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggcccggcggacgttacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtgccggaaggacaagtcatgaaacaagagccgtca
gccggcactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacgctaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggaccacagcatctctgatacg
tatgactcatttaaaataaaagagccgaccgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattatcaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system