KEGG   Bacillus amyloliquefaciens LFB112: U722_10430Help
Entry
U722_10430        CDS       T02965                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00020  Citrate cycle (TCA cycle)
bamf00310  Lysine degradation
bamf00380  Tryptophan metabolism
bamf01100  Metabolic pathways
bamf01110  Biosynthesis of secondary metabolites
bamf01120  Microbial metabolism in diverse environments
bamf01130  Biosynthesis of antibiotics
bamf01200  Carbon metabolism
Module
bamf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    U722_10430
  09105 Amino acid metabolism
   00310 Lysine degradation
    U722_10430
   00380 Tryptophan metabolism
    U722_10430
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     U722_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AHC42499
LinkDB All DBs
Position
complement(2108890..2111724)
Genome map
AA seq 944 aa AA seqDB search
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASE
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDPKKSELFPLSEYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEKAQNIEMAVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCASSFTVHN
SPLSEGSVLGFEYGYNVYSPETLVLWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHAYEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDTKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLT
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataatatgaaacaaagaatgaattgggaagatttttacggaccgaacctc
ggctacgcactggagctgtacgaccaatatgctgaagatccagacagcattgatccggat
ctgaaagacatgtttgacgaactaggcgctccgccaagccaaataaaagaggcatcggaa
acaaaggaacagggacgcgtcaccgcagatctgattcaaaagatcgcagcagcagttaaa
cttgcagaagatattcgaacctatggccatctgaacgcttccgtcaatccgctcagaaag
gatccgaaaaagagcgagctctttccgttatccgagtacgggcttacagaagaagaaatg
aaagcaatacccgcgtctgtcatctgtaaagacgcacctgccaatataacaaacggctta
gaagccatccagcatttacgcaatacctataaaagaaccatctctttcgagtttgaccat
gtgcatgatttcgaagagcgcgcgtggattacaaaaatggtcgaatccggcgaactgttc
cggaaaaattcaccggaaaaactgtcagccgttttagaaagactgacggaagtagaaggg
tttgaacaatttttacaccggacattcgtcggtcagaagcgtttctcaattgagggatta
gacgcgcttgtgccggttcttgacgacattatcgcccagtctgtgaaagcgggcacaacc
aatgtcaatatcgggatggcgcacagaggccgtttaaatgtgcttgcgcatgtgctcggc
aaaccgtatgagattattttctcagaattccagcacgcgccgaataaagaccttgtgccg
tctgaaggatcgaccggcatcagctacggctggacgggcgatgttaaataccacctcggt
gcagacagacagcttcaggatgctgaaaccaaaagcgcgcggattacgcttgcaaataac
ccgagccacttggaattcatcaatccgattgtggaaggaagcacgcgggcggcacaggaa
acaagaacgcaaaaggggtacccggttcaagacgaaacaaaatcgctcgccattttaatt
cacggtgacgcagcgttcccgggagaaggcattgtcgccgagacgctgaacttaagctca
ctgaaaggctatcaggtgggcggggccattcatatcatcgccaataatatgatcggcttt
acaactgaaagcgatgaatcacgatccacaaaatatgccagtgatttggcgaagggttat
gaaattccgatcgttcacgtcaacgcggatgatccggaagcatgcctgtcagccgttaaa
tttgcggttgaataccggaagcggttcaataaagatttcttaatcgatttaatcgggtac
agacgatacggccacaatgaaatggatgagccgtcaacgacacagccgatgctgtatgat
gccgtcagaaaacacccgactgtcaagcggatctttgcggaaaaactcgtaagtgaagga
ctgatcagcgaggaaaaagcgcaaaacatcgaaatggcagtgacaaaacgaattgaagac
gcctataaaaaggtgcccgccaaaaaagaagacgccgtacgggaaattgaattgccggag
ccggtgtccaacggttttccagacgttgatacagccattgattttgatgttctccgcaag
ctgaacggcgaacttatcaactggccggaatcctttaacgtgttcggcaaactgaaaaga
atcctggaaagacgtgcaaaagcgtttgatgatgaccgtaaagttgaatggtcattggct
gaatcgcttgcgtttgcttccattttgaaagacggcacgccgatccggctgaccgggcag
gattcagagcgcggaacgttcgctcaaagaaaccttgtgctgcatgacagcgaaacagga
gaagaatttgttgctctccatcacttagacgactgcgcttcttcatttacggtgcataac
agcccgctctctgaaggatcggttctcggctttgaatatggatacaacgtgtattcgcct
gaaacgcttgtgttgtgggaggcgcagtacggggactttgccaatgcggctcaagtctat
tttgatcaattcatatctgcaggacgggcaaaatggggacaaaaatcagggctggtcatg
ctgctgcctcacggttacgaaggacagggccctgaacactccagcggccgcgtcgagcgg
ttcctgcagctggcggcggaaaacaactggacagtggccaacctgacaagtgcggctcag
tatttccacattttaagaagacaagcgaaaatgctgcttcgtgaggaaatccgcccgctt
gtgatcatgacgccgaagagcctgctgcgcaacccgaatacggtatctgaagtgcaggaa
ctgagcgaaagccgattcaagcctgtctatgagcagtccggtctttcccatgcttacgaa
aaagtgactcgcgtcgtattatcaagcggaaaagtgtcaattgatatcagcgatcacttc
aacaaaatggaaggcgataaggattggcttcatattgccagaatcgaacagctgtatccg
ttcccggcaaaagatacgaaggagcttttcgccaaactgccgaacctgcaagagatcgtt
tgggttcaggaagagccgcagaacatgggggcatggagttatatcagcccgtatctgacg
gaaattgcgccaaaaggagtaaatgtccaatacatcggccgaagaagacgatccagtccc
gcagaaggagatccgacagtccacaaaaaagaacaggaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system