KEGG   Bacillus amyloliquefaciens LFB112: U722_11515
Entry
U722_11515        CDS       T02965                                 

Definition
(GenBank) hypothetical protein
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    U722_11515
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     U722_11515
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox FAD_binding_3 FAD_binding_2 NAD_binding_8 DAO Thi4 GIDA NAD_binding_7 K_oxygenase FAD_oxidored Lycopene_cycl
Other DBs
NCBI-ProteinID: AHC42695
LinkDB
Position
complement(2284288..2285271)
AA seq 327 aa
MTEEKAIIIGGGPCGLSAAIHLKQIGVNALVIEKGNVVNSIYNYPTHQTFFSSSEKLEIG
DVAFITENRKPVRIQALSYYREVVRRKELRVNAFETVERVTKQEDGRFLVETSKDRYLTP
FCIIATGYYDHPNYMNIPGEGLPKVFHYFKEGHPYFDKDVAVIGGKNSSVDAALELVKSG
ARVTVLYRGHEYSPSIKPWILPEFEALVRNGTIRMEFGACLEEVTEDEIIFRSGRNETVR
LKNDFVFAMTGYHPDHGFLEKIGVQIDAESGRPFFREETMETNVDGVFIAGVIAAGNNAN
EIFIENGRFHGGLIANEISKRLGAESI
NT seq 984 nt   +upstreamnt  +downstreamnt
atgacagaagaaaaagcaattataataggcggaggtccttgcggattatcggcggctata
catctgaagcaaattggcgtgaacgcgcttgtgatcgaaaaagggaatgtcgtaaacagc
atttataactatccgacccaccaaacttttttcagttcaagtgaaaaattggagatcggc
gatgtcgcctttattacggaaaacagaaaaccggtccgaatacaggctctctcttactac
agagaggttgtcagaagaaaagagctgcgcgtaaacgcctttgaaacggtggaacgcgta
acgaaacaggaagacggccgttttcttgtagaaacgtcaaaagaccgctacctcactccg
ttttgtatcattgcgacaggatattatgatcatccgaattatatgaacataccgggtgaa
gggcttcctaaggtatttcattactttaaagaaggccatccttattttgataaagatgtt
gctgtgatcggcgggaaaaactcaagtgtggacgcggctttggaactcgtgaagtccggt
gcgcgcgtcacggtgctctacagaggacatgagtattccccgagcatcaagccgtggatt
ctgcctgagtttgaggcccttgtcagaaacggcacaatccggatggaattcggcgcttgt
cttgaagaagtgacggaagatgaaatcattttccgctccggccgaaatgagacggtccgg
ctgaaaaacgatttcgtatttgccatgacggggtaccatcccgatcacggtttcctcgaa
aaaatcggggtgcagattgatgctgaatcaggccggccgtttttccgggaagaaacgatg
gaaacaaatgttgacggtgtttttatcgccggagtcattgcggctggaaataacgccaat
gaaatttttatcgagaacggccgttttcacggcggcttgatcgcaaacgaaatatcaaaa
cggctgggtgcagagagcatatga

DBGET integrated database retrieval system