KEGG   Bacillus amyloliquefaciens LFB112: U722_12170
Entry
U722_12170        CDS       T02965                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00010  Glycolysis / Gluconeogenesis
bamf00020  Citrate cycle (TCA cycle)
bamf00260  Glycine, serine and threonine metabolism
bamf00280  Valine, leucine and isoleucine degradation
bamf00310  Lysine degradation
bamf00380  Tryptophan metabolism
bamf00620  Pyruvate metabolism
bamf00630  Glyoxylate and dicarboxylate metabolism
bamf00640  Propanoate metabolism
bamf01100  Metabolic pathways
bamf01110  Biosynthesis of secondary metabolites
bamf01120  Microbial metabolism in diverse environments
bamf01200  Carbon metabolism
Module
bamf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bamf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U722_12170
   00020 Citrate cycle (TCA cycle)
    U722_12170
   00620 Pyruvate metabolism
    U722_12170
   00630 Glyoxylate and dicarboxylate metabolism
    U722_12170
   00640 Propanoate metabolism
    U722_12170
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U722_12170
   00280 Valine, leucine and isoleucine degradation
    U722_12170
   00310 Lysine degradation
    U722_12170
   00380 Tryptophan metabolism
    U722_12170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamf04147]
    U722_12170
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     U722_12170
Exosome [BR:bamf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   U722_12170
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored Pyr_redox_3 FAD_binding_2 GIDA DAO NAD_binding_8 FAD_binding_3 3HCDH_N AlaDh_PNT_C K_oxygenase HI0933_like Trp_halogenase Thi4 NAD_binding_7 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AHC42822
LinkDB
Position
complement(2448512..2449933)
AA seq 473 aa
MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVY
RTAKEAAAFGIETEGVSLRFDSVQKRKQGIVDRLAGGVAHLMKKGKIDVFNGYGRMLGPS
IFSPLPGTVSVEYANGEENDMLIPKQLIIATGSRPKMLPGLEADGTYILTSDEALELERL
PQSMLIVGGGVIGIEWASMLNDFGVNITVIEYADRILPTEDRDISSEMEKLLTKKGIKIV
TGAKVLPDTLEKADGVSIAAEKNGKKETYHAEQMLVSIGRQPNIEGIGLENTDIAAENGS
IIVNEAGQTKESHIYAIGDVVGGLQLAHVASREGIIAVEHMAGLNPAPLDAALVPKCIYS
NPEAASVGLTEEEAARKGHELKIGKFPFMAIGKALVYGESDGFVKIVADRNTDDILGVHM
IGPHVTDMISEAGLAKVLDATPWEIGQSIHPHPSLSEAIGEAALAADGNAIHF
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgactgaatatgatgtggtcattctgggcggcggcacgggcggttatgtagccgcc
atcagagcggcccagctcggcttaaaaacggccgttgtagaaaaagaaaagctcggcgga
acatgcctgcataaaggatgtatcccgagtaaagcgctgttaagaagcgcggaagtgtac
cgaaccgcaaaggaagcggcagcattcggcattgaaacggaaggtgtctccctccgcttt
gacagcgtgcaaaaacgaaagcagggaatcgttgaccggctggccggcggtgtcgcccac
ttgatgaaaaaggggaagattgatgtattcaacgggtacggacgtatgctcggcccttcc
atcttctcacctcttcccggtacggtttccgtcgaatacgcaaatggtgaagaaaacgac
atgctgataccgaaacaattgattatcgcaaccggttcaaggccgaaaatgctgccgggt
ttagaagcagacggtacatatattctgacatcagatgaagcgcttgagcttgagcgtctg
ccccaatccatgttgatcgtcggcggcggtgtcatcggaattgaatgggcatccatgctg
aacgatttcggcgtcaatatcactgtgattgaatatgcggaccgcattttgccgactgaa
gaccgtgatatctcaagcgagatggaaaaactgttaacgaaaaaaggaattaagattgta
acgggtgcgaaagtgcttccggatacattggaaaaagcggatggcgtttcaattgccgct
gaaaagaatggaaaaaaagaaacgtatcacgccgaacaaatgcttgtttccatcggccgc
cagccgaacattgaagggatcggtcttgaaaacacggacattgcagcggaaaacggttct
atcatagtaaatgaagccggacagacgaaggaatcgcatatttatgcgatcggtgatgtc
gtcggcggtctgcagcttgcgcatgtggcctcccgtgaaggcatcattgccgttgagcat
atggcgggtcttaatccggctccgcttgatgccgctcttgtgccgaaatgcatttattca
aatccggaagcggcgagtgtcgggctgacagaagaagaagctgcccgaaaaggacatgaa
cttaagatcggaaagtttccgttcatggcgatcggaaaggctcttgtatacggagaaagc
gacggctttgtcaaaatcgtcgccgatcggaatacagatgatattctcggtgttcatatg
atcggcccgcacgtcaccgatatgatctctgaagcggggcttgccaaggtgctcgacgcg
acgccttgggaaatcggccagtccatacatccgcatccgtcgctttcagaagcgattggg
gaagctgcgttagccgcagacggaaacgcgattcatttttaa

DBGET integrated database retrieval system