KEGG   Bacillus amyloliquefaciens LFB112: U722_14225Help
Entry
U722_14225        CDS       T02965                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00010  Glycolysis / Gluconeogenesis
bamf00030  Pentose phosphate pathway
bamf00051  Fructose and mannose metabolism
bamf00052  Galactose metabolism
bamf00680  Methane metabolism
bamf01100  Metabolic pathways
bamf01110  Biosynthesis of secondary metabolites
bamf01120  Microbial metabolism in diverse environments
bamf01130  Biosynthesis of antibiotics
bamf01200  Carbon metabolism
bamf01230  Biosynthesis of amino acids
bamf03018  RNA degradation
Module
bamf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bamf_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U722_14225
   00030 Pentose phosphate pathway
    U722_14225
   00051 Fructose and mannose metabolism
    U722_14225
   00052 Galactose metabolism
    U722_14225
  09102 Energy metabolism
   00680 Methane metabolism
    U722_14225
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    U722_14225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bamf01009]
    U722_14225
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bamf03019]
    U722_14225
Enzymes [BR:bamf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     U722_14225
Protein phosphatases and associated proteins [BR:bamf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     U722_14225
Messenger RNA biogenesis [BR:bamf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     U722_14225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AHC43223
LinkDB All DBs
Position
complement(2825122..2826081)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcgggaaaatagaaaaactggagctgggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtatacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaattttaattcctgaagcggactacgatatggaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system