KEGG   Bacillus amyloliquefaciens LFB112: U722_14360Help
Entry
U722_14360        CDS       T02965                                 

Definition
(GenBank) acyl--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00010  Glycolysis / Gluconeogenesis
bamf00620  Pyruvate metabolism
bamf00630  Glyoxylate and dicarboxylate metabolism
bamf00640  Propanoate metabolism
bamf00680  Methane metabolism
bamf01100  Metabolic pathways
bamf01110  Biosynthesis of secondary metabolites
bamf01120  Microbial metabolism in diverse environments
bamf01130  Biosynthesis of antibiotics
bamf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U722_14360
   00620 Pyruvate metabolism
    U722_14360
   00630 Glyoxylate and dicarboxylate metabolism
    U722_14360
   00640 Propanoate metabolism
    U722_14360
  09102 Energy metabolism
   00680 Methane metabolism
    U722_14360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bamf01004]
    U722_14360
Enzymes [BR:bamf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     U722_14360
Lipid biosynthesis proteins [BR:bamf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   U722_14360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_L6e_N
Motif
Other DBs
NCBI-ProteinID: AHC43249
LinkDB All DBs
Position
complement(2851013..2852599)
Genome map
AA seq 528 aa AA seqDB search
MLKREDLIAPKNYNLVNEIEKFSRSKEKNALIWEDQTGGKKVWTYEKLMEETNKIGARLK
GLGFEKGDKLIVMVPRVLEAYAVYLAILKAGMVVIPCSEMLRAKDLEYRIKHAEVKGAIV
YPSFINAFDEVNTEQLVTLSIGENDAGWKNLLTIEADGNSFQTADTTREDMAFLSYTSGT
TGQPKGVVHTHGWAFAHLKTSAGAWLDISEDDTVWATAAPGWQKWVWSPLLAVLGSGATG
FIYHGRFNAKTYLELLERHQVNVFCCTPTEYRLMAKVEELDKYDLSALHSAVSAGEPLNR
EVIDVFRKHFGIKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEIINDKGEICE
TGETGDIAVHLSTPALFKEYYKDPERTKKQIRGDYFLTGDRAKKDEDGYFWFESRNDDII
VSSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQDDEKRSDELVKELQ
NHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRQREERLKADKKA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgagaagatttaatcgccccaaagaactataaccttgtaaatgaaatcgaa
aagttcagccgttccaaagagaagaacgcgcttatttgggaagatcaaacaggcggcaag
aaagtctggacgtatgaaaaattgatggaagaaacgaataaaatcggagcccgcctgaaa
ggtctcggatttgaaaaaggcgataagctgattgtcatggttccgagagtgcttgaagcg
tatgccgtttatttagcgatcttaaaagcggggatggtcgtcattccttgctcggaaatg
ctgcgcgccaaagaccttgaataccggatcaaacacgccgaagtgaaaggcgctatcgtt
tatccttcatttataaacgcatttgacgaggtgaataccgagcagctggtgacattgtca
atcggtgaaaatgatgccggctggaaaaacctcttaacgattgaagcggacggaaacagt
tttcaaacagctgatacaacaagagaggacatggcgtttttgtcctatacttcagggacg
accggccagcctaaaggcgttgtacatacacacggctgggcctttgcccatttaaaaaca
tcagccggtgcatggctggatatttccgaagacgatacagtgtgggccaccgcggcgccc
ggctggcagaaatgggtgtggagcccgctgctcgccgttctgggaagcggcgcgacagga
ttcatttatcacggcagattcaacgccaagacgtatttagagctgctggagcgccatcaa
gtaaatgtcttctgctgtaccccgacggaataccgcctgatggcaaaagtggaggagttg
gacaaatatgatctttctgcccttcacagcgcagtttctgcgggtgagccattaaaccgg
gaagtcattgacgtattccggaagcatttcggtattaaagtgagagacggatacggccaa
acggagagcaccctgttagtcggcgtcctgaaggatatggatattaagccgggaagcatg
ggcaaaccgacccccggaaatcaagtagagattataaacgataagggcgaaatatgcgaa
acaggcgaaacgggcgatatcgccgtgcatttgagcacaccggccttattcaaggaatat
tataaagatcccgaaagaacgaaaaagcagattcgcggagattattttcttacaggagac
cgcgcgaaaaaagacgaggacggctacttttggtttgagagccgcaatgatgacattatc
gtcagctccggatatacaatcgggccttttgaagtagaggacgcgctcgtgaagcatccg
gaagtgaaagaatgtgcagtcgtggcaagcccggatgaaatcagaggttcaatcgtaaaa
gcttatgtcgttttacaagacgatgaaaagcgcagtgacgaacttgtcaaagaactgcaa
aaccacgtaaaaacgattacggcgccttacaaatatccgagagaaattgaatttgtcgaa
agcctgccgaaaacggcgtccgcaaaaatcagacgtgtggaactgagacagcgtgaagaa
cggctgaaggctgataaaaaagcataa

DBGET integrated database retrieval system