KEGG   Bacillus amyloliquefaciens LFB112: U722_17175
Entry
U722_17175        CDS       T02965                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
bamf00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bamf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    U722_17175
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     U722_17175
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_binding_2 GIDA FAD_oxidored Thi4 NAD_binding_8 K_oxygenase HI0933_like FAD_binding_3 Lycopene_cycl NAD_binding_7
Other DBs
NCBI-ProteinID: AHC43766
LinkDB
Position
complement(3365222..3366172)
AA seq 316 aa
MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTEDVENYPGFESIL
GPELSNKMFEHAKKFGAEYAYGDIKEIVDGKEYKTVKAGSKEYKARAIVISAGAEYKKIG
VPGEKELGGRGVSYCAVCDGAFFKNKELVVVGGGDSAVEEGVYLTRFASKVTIVHRRDKL
RAQSILQARAFDNEKIDFKWNKTVKEIHEENGKVGRLTLVDTVTGEEEEFKADGVFIYIG
MLPLSKPFENLGITNEEGYIETNAQMETKVPGIFAAGDIREKTLRQIVTATGDGSIAAQS
VQHYVEELEETLKTVK
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgtcagaagaaaaaatttatgatgtgatcattatcggcgcgggtccggcggggatgacc
gctgctgtttacacatcacgagcgaacttatccacattaatgatcgaaagaggaattccg
ggcggccagatggccaatacggaggatgttgaaaactatccgggttttgaaagcattctc
ggccctgaactttctaataaaatgtttgaacatgcgaaaaaattcggtgcggaatatgcg
tacggcgatattaaagaaatcgtggacggtaaagaatataaaacggtcaaagccggttca
aaagaatataaagcgcgcgccatcgtcatttctgccggagcggaatacaaaaagatcggc
gttcccggcgaaaaagaactgggcggccgcggcgtatcgtactgcgcggtttgtgacggc
gcgttctttaaaaataaagagcttgtcgttgtcggcggcggagactccgccgttgaagaa
ggcgtctatctgacacgcttcgcttcaaaagtcaccatcgttcacagacgtgacaaattg
cgtgcgcaaagcattcttcaggcgcgtgcctttgacaatgagaaaattgactttaaatgg
aacaaaaccgtaaaagaaatccatgaggaaaacggaaaagtcggcagacttactcttgtg
gataccgtgacgggagaagaggaagaattcaaagctgacggtgtctttatttatatcggt
atgcttccgctttctaaaccgttcgaaaacttgggcatcacaaatgaagaaggctacatt
gaaacaaatgcccaaatggagacaaaagtcccaggcattttcgctgcgggagacatccgt
gaaaaaacgctccgccagatcgtaacggcgacaggcgacggaagtattgcggctcaaagc
gttcagcattatgtggaagagcttgaggaaacgctcaaaaccgttaaataa

DBGET integrated database retrieval system