KEGG   Bacillus amyloliquefaciens IT-45: KSO_000605Help
Entry
KSO_000605        CDS       T02462                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bami  Bacillus amyloliquefaciens IT-45
Brite
KEGG Orthology (KO) [BR:bami00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KSO_000605
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KSO_000605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGF25627
LinkDB All DBs
Position
complement(114100..115629)
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGDDDTSKDMLALVDELASMSSKISVEKTELNR
TPSFSVNRTGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKNIMAVPTVFLNGESF
GSGRMTIEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKDYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVHKNAQTKEITGDQNVNGITF
VDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIIVDKSGATSVPGLFAAGDC
TDGPYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatacatgcagctaattgagaac
gacattgttctcaaagtaagcgccggtgacgatgacacttctaaggacatgctggctctc
gttgacgaactggcttccatgtcatctaaaatttcagttgaaaaaactgaattaaacaga
acaccgagcttcagcgttaatcgtaccggagaagacacaggcgttacattcgccggtgtt
cctctcggccacgaatttacatcattagtgctggcattgcttcaagtcagcggcagagcg
cctaaggctgatcaaaaggtcattgaccagattaagaacatcagcggagaataccgcttt
gagtcttatatcagcctgacgtgccacaattgccctgatgtcgtccaagcattaaacatg
atgagtgtgctcaacccgaatatcacacatacaatgattgacggcgcggcattcaaagaa
gaagtagaaagcaaaaacatcatggctgttccgactgttttcttaaacggtgaatctttc
ggcagcggccgtatgaccatcgaagagattctcgcgaaaatgggcagcggcgcagatgcg
tctgagtttgccgacaaagagccgtttgacgttcttgttgtcggcggcggacctgccggc
gcaagcgcggcgatctacacggcgcgtaaaggcatccgcaccggtgtcgtcgctgaacgc
ttcggcggccaggtactcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgact
gaaggaccgaagctcgctgcaagccttgaagagcacgtgaaagattatgatattgacgtc
atgaaccttcagcgcgcgaaacgccttgagaaaaaagacctcttcgaacttgaacttgaa
aacggcgctgtactgaaaagtaaaacagtgatcctttcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgagcaagagttcaaaaacaaaggtgttgcatactgcccgcactgt
gacggaccattatttgaaggcaaagacgtagccgttatcggcggcggaaactccggaatc
gaagcggcgattgaccttgcaggtatcgtcaatcacgtgactgtgctggagttcgcacct
gaactgaaagcagacgaagtcctgcaaaaacgtctttacagcctgccgaacgtcactgtg
cacaaaaatgcacaaacgaaagaaatcacaggcgaccaaaacgtaaacggcattacgttc
gttgaccgtgaaacaggcgaagaaaaacacgttgaactccaaggtgtattcgtccaaatc
ggtctcgtgcctaatacagaatggttagacgaaaccgtcgaacgcaaccgcatcggcgaa
atcatcgtcgataagagcggcgcgacaagcgttcccggcctatttgccgcaggggactgc
acagacggcccgtacaaccaaatcattatctccatgggatcaggtgcaactgccgcttta
ggcgcatttgattatttgatccggaattaa

DBGET integrated database retrieval system