KEGG   Bacillus amyloliquefaciens IT-45: KSO_001620
Entry
KSO_001620        CDS       T02462                                 

Definition
(GenBank) transaminase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00998  Biosynthesis of various secondary metabolites - part 2
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
Module
bami_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    KSO_001620
Enzymes [BR:bami01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     KSO_001620
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AGF25827
LinkDB
Position
309572..310771
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVEALREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAKLHEMPLHPENGYLPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGNPEHTERLKRTYKE
RIDFFTALCVKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLENAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVLRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgatgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagcccagattattaatctcggccagggg
aatcccgatctccccactccgccgcatatcgttgaagcattgcgggaagctgcgctgaat
ccttcatatcacggatacggccctttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagcaggtttgtacgttttgacgcaatgcctgctgaaccccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggaatcacaatggccagagcg
aagctgcatgagatgccgcttcatccggaaaacggctatctgccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcgactgcggatcaggcgttttatgaaaaagcggctgcgtttgcaaaaaaacatgac
atccatcttattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagc
tttcttcaggcgaaagaagcgaaaacggtcggcgcggagctttattcattttcgaaaacc
ttcaatatggcaggctggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtcttcgtcggcatgttcggcggccttcagcaggcggca
gcggcggcgctgtcaggaaatcctgagcatacggagcgtctgaagcgcacatataaagaa
cggattgattttttcacggcgttatgtgtaaaggaattaggctggagcattgaaaaaccg
aaagggactttttatgtctgggctgaaattccgaatgaattcgagtcttcacaccagttt
tcggactatctgctggagaatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcagaatatcaatggtggcaaaacagggcgatttaagggaattc
gtgctgcggattcaaaagctaggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system