KEGG   Bacillus amyloliquefaciens IT-45: KSO_004155Help
Entry
KSO_004155        CDS       T02462                                 

Definition
(GenBank) MFS transporter DHA2 family multidrug resistance protein B
Organism
bami  Bacillus amyloliquefaciens IT-45
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr MFS_3 OATP MFS_2 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AGF26328
LinkDB All DBs
Position
complement(790429..792024)
Genome map
AA seq 531 aa AA seqDB search
MSIEKKDPKRTLLITGLIIAMFFSALDGTIVGTAIPKIVGDLGGLSMMTWLTTAYLLTST
TIVPIAGKLADLLGRRVVYVSGLLIFMGASALCGMASNMTELIIFRGLQGIGGGVMMPMA
MIVIGDLFTGKQRAKFQGLFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGILAVI
FIARGLQGRKQTGPINFDIAGIFTMIVGIVSLLLALSFGGKDYAWGSWQILGLFALALAG
IVGFIFAEIKAKEPILPMYLFKNRTFTVLNLIGFFMSIGMFGAVTFVPFFMQGIIGVSAT
ASGTIMTPMMVSMIITSIIGGQLVYKIGIKPQIMIGMLIMAVGFFLLTTLQLDTSKLAAT
CYMAVIGLGMGLVMPLLTLALQETFSKEELGVVTSSSQFFRMIGGTFGITVLGAVMNARS
GSLLTDRLVPYLDSLPKQASAFAAQFKGMIDKNPEGLLQSLFSQESIKQIPAAFSSHIVP
VLKTSLMDSLHSVFFTGLAFIAAGLILTLFVKSITLTNKKTGKQEEKAKAV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaaaagaaagatccaaaacgcacattattaataacaggcttaatcatcgcc
atgtttttctcagcccttgacggcaccatcgtaggaacggcgattcctaaaatcgtgggt
gacctcgggggattaagcatgatgacctggctgaccacggcatatcttttaacttcgacg
acgatcgttccgattgcggggaaacttgcagatttattggggcgccgcgtcgtctatgtg
tcaggtttattgatttttatgggagcttccgcactgtgcggaatggccagcaacatgacg
gaactgattattttccgcggacttcagggaatcggcggcggtgtcatgatgccgatggcc
atgatcgtcatcggggatttgttcacagggaaacagcgtgccaagttccaagggcttttc
ggggcgatttacgggcttgcttccgttatcggcccgcaaatcgggggctggattgttgac
tcattaaattggaaatgggttttctatatcaacctgcctgtcggaatcttagccgtgatc
tttatcgcaagaggacttcagggcagaaaacagactgggccgattaactttgacattgcc
ggcattttcacaatgatcgtcggaatcgtcagcctccttctcgcgctcagcttcggagga
aaggattacgcatggggctcttggcagattctcggtctctttgcgcttgcgcttgccggg
attgtcggattcattttcgctgaaatcaaagcaaaagaaccgattctgccgatgtacctg
tttaaaaacagaacgtttaccgtactgaatctgatcggctttttcatgagtatcggcatg
ttcggcgccgttacgttcgttcctttctttatgcagggaattatcggagtcagcgccacc
gcgtcaggcacgattatgacgccgatgatggtatctatgattatcacaagtattatcgga
ggccagctggtttataagatcggtattaaaccgcaaatcatgatcggcatgctgatcatg
gccgtcggcttcttcttattaacgaccttacagctggatacaagcaagctcgcggctacg
tgctatatggccgtgatcggtctgggaatggggctcgtcatgccgcttctcacactcgct
ctgcaagaaacgttttcaaaagaagagctgggcgttgtgacttcatcaagccaatttttc
cggatgatcgggggaacgttcggcattacggtgctcggcgctgtcatgaatgccagatca
ggaagccttttaaccgacagactggtgccttacttagactcactcccgaaacaggcaagt
gcctttgccgcccagtttaaaggtatgattgacaaaaatcctgaagggctgcttcaatcc
ttgttcagtcaggaatcgattaagcagatcccggccgcattttcttcccatatcgtgccg
gttttgaaaacgtcactgatggattcgcttcacagcgtgtttttcacaggcctggccttt
atcgctgccggattgatcctcacgctgtttgttaaatcaattacgctgacaaacaaaaag
acaggcaaacaagaagaaaaggcgaaagccgtttaa

DBGET integrated database retrieval system