KEGG   Bacillus amyloliquefaciens IT-45: KSO_004185Help
Entry
KSO_004185        CDS       T02462                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00071  Fatty acid degradation
bami00362  Benzoate degradation
bami00650  Butanoate metabolism
bami01100  Metabolic pathways
bami01120  Microbial metabolism in diverse environments
bami01200  Carbon metabolism
bami01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KSO_004185
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KSO_004185
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSO_004185
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KSO_004185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA AlaDh_PNT_N
Motif
Other DBs
NCBI-ProteinID: AGF26334
LinkDB All DBs
Position
794604..796973
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALVYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERLEEEGA
ALPGWVKEMLDQGHETFYMKENGTQFYYSDGQYRAVKENPKRISLQTLKETKGVITKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETERNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLDGGSELMDAAIKTFETIALAKVSGSAHEARD
MKILSAADRISMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcaga
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataacggcggggaatttggaagatgacgcagctcaattgaaggat
gctgattggattattgaagtcgtcgtcgaaaaccttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcattgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgttctgccgattttaaggctcatttcttaggaacccat
ttctttaatccggcccgctacttgaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgcttgggaaaggtgtcgtc
atcgcaaaagacacgccaaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgacaggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
actttcgctcatgtggcaaaaaacgtatatgataaagccgacggcgctgaaaaagacatg
tttaagcttcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgatccgctgaccatg
acatacggtgagcgctccaaaatgaaaacgcccgctttagaagccgccaaacaggcaaag
ggtgccaaaggaaaaatgaaagcgcttgtatattccgatgaccgcgccggacgcctgctt
tggaatatcacatcgcaaacactcttatactcagcccggcttttaggtgagatcgctgat
gatataaaagcgattgacgacgccatgaaatggggcttcggatgggagctcggaccgttt
gagatgtgggatgccatcggtgtcagaaaatcagcggagcggctcgaagaagaaggcgca
gcactccccggctgggtgaaagagatgcttgatcagggtcatgaaacattttatatgaag
gaaaacggaacacaattttattattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcagacgttaaaagaaacaaaaggcgttatcactaaaaacagcggc
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaacggagcggaat
tataaaggtcttgtcatcggaaaccaaggcagacatttctgcgcgggagcaaaccttgcg
atgattttaatggaagcccaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtagcggcgccattc
gggatgacactcggcggaggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtctcgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttggacggcggaagtgaactcatggacgcagcgatt
aaaaccttcgaaacaatcgcgcttgccaaggtgtccggttcggcacacgaagcccgtgac
atgaagattttgtccgcggcagaccgtatcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgtccgcctgcccgcaaaaaa
gtgaaagttaccggagaaaccggctgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcacggaggtttcagaagaatatttactcgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system