KEGG   Bacillus amyloliquefaciens IT-45: KSO_004190Help
Entry
KSO_004190        CDS       T02462                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00071  Fatty acid degradation
bami00280  Valine, leucine and isoleucine degradation
bami00281  Geraniol degradation
bami00362  Benzoate degradation
bami00592  alpha-Linolenic acid metabolism
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
bami01120  Microbial metabolism in diverse environments
bami01130  Biosynthesis of antibiotics
bami01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KSO_004190
   00592 alpha-Linolenic acid metabolism
    KSO_004190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSO_004190
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    KSO_004190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSO_004190
   00642 Ethylbenzene degradation
    KSO_004190
Enzymes [BR:bami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     KSO_004190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGF26335
LinkDB All DBs
Position
796984..798159
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLAAVRPDDLGALCVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMIGAGDTVIAGGAESM
SQVPMMGHVTRPNIALAEHAPEYYMSMGHTAEQVAETYGVSREDQDAFAVRSHQNAAKAL
KEGKFNDEIVPVEVSLTEVGDDHKPRKKQFTFSQDEGVRPGTSADVLAKLRPAFSKTGTV
TAGNSSQTSDGAAAVMLMAREKASSLGLAPLVKFRSFAVGGVPPEVMGIGPIEAIPRALK
LAGLELQDIGLFELNEAFASQAIQVIRSLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattgtggccggtgcgagaaccccggtcggtaaagcgaaaaaagga
tcgcttgcagccgttcgtcctgatgatttaggcgcgctttgtgtaaaagaaacgctgaaa
cgggcaggcggctatgaaggaaatatcgatgacttaattatcggatgtgcaacacctgaa
gccgaacaaggattaaatatggcgcggaatatcggtgcgctggcggggcttcctcatacg
gtgccggccattacggtgaatcgctactgctcttccgggctccaatccatcgcttacggt
gctgaaaaaattatgatcggcgcgggtgataccgtcattgcgggcggtgcggaatccatg
tcgcaagttccgatgatggggcatgtgacacggccgaatatcgctttggcggagcatgcg
cctgagtattacatgagcatggggcacacagcggagcaggtcgccgaaacgtacggggta
tccagagaagaccaggatgcatttgcagtccgcagccatcagaatgccgcaaaagccctt
aaggaagggaaattcaatgacgaaatcgtgccggttgaagtatcgctgacagaagtcggt
gatgaccataagccgcggaaaaaacaatttaccttttctcaggatgaaggcgttcgtccc
ggcacgtcggctgacgtcttggcgaagctccgcccggctttttctaaaacgggaaccgtg
acggccgggaactcttcacaaacaagtgacggcgcggcggctgtcatgctgatggctcgc
gaaaaagcatcgtcgctcggattggccccgcttgtcaaattccgttcctttgccgtaggc
ggcgttccgcctgaggtaatggggatcggtccgattgaagccattccgcgggcgctcaag
cttgccggactcgaattacaggatatcgggctttttgaattgaatgaggcctttgcttca
caggccattcaagtcatcagatcgctcgggatagatgaagaaaaggtgaacgtcaacgga
ggcgccatcgcgctcggacatccgctcggctgcacggggacgaagctgaccctgtcactc
attcatgaaatgaaacggagaaacgagcaattcggcgttgtgacgatgtgcatcggaggc
ggcatgggcgctgccggcgtatttgaactcatttaa

DBGET integrated database retrieval system