KEGG   Bacillus amyloliquefaciens IT-45: KSO_004590Help
Entry
KSO_004590        CDS       T02462                                 

Definition
(GenBank) hypothetical protein
  KO
K09775  uncharacterized protein
Organism
bami  Bacillus amyloliquefaciens IT-45
Brite
KEGG Orthology (KO) [BR:bami00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    KSO_004590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF212 PAP2
Motif
Other DBs
NCBI-ProteinID: AGF26415
LinkDB All DBs
Position
complement(865004..865480)
Genome map
AA seq 158 aa AA seqDB search
MDVLMNFPLLASFAAIIFAQVVKVPIQFIVSKKLDWSLVTSTGGMPSSHSAAVTALSTGI
ALEQGLDSPLFAVAAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVSEAKDFQKAE
EKEKQKKLKELLGHQPIEVFFGGVTGIVLTLILDYFFM
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggatgtacttatgaattttcctttactggcgagttttgcggccattatttttgcccaa
gttgtaaaagtgcctattcaatttatcgtatccaaaaaacttgactggtctcttgtgacg
agcaccggcggcatgccgagctcccattccgccgccgtcaccgcgctgtcaaccggaatc
gctttggaacagggactggactcgcccctgtttgcagtcgccgcgattttcgccgtcatt
acgatgttcgatgctacaggtgtcaggcggcatgcgggtgaacaggcgacagtcattaat
aaactggtcatcgactttaatcggtttgtcagcgaagcgaaggactttcagaaagcggaa
gagaaagaaaaacagaagaaactgaaagaactgctcggccatcagccgattgaagtgttc
ttcggcggcgtcaccggtattgtgctgacattgattttagattatttctttatgtaa

DBGET integrated database retrieval system