KEGG   Bacillus amyloliquefaciens IT-45: KSO_005910Help
Entry
KSO_005910        CDS       T02462                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00010  Glycolysis / Gluconeogenesis
bami00030  Pentose phosphate pathway
bami00051  Fructose and mannose metabolism
bami00052  Galactose metabolism
bami00680  Methane metabolism
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
bami01120  Microbial metabolism in diverse environments
bami01130  Biosynthesis of antibiotics
bami01200  Carbon metabolism
bami01230  Biosynthesis of amino acids
bami03018  RNA degradation
Module
bami_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bami_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSO_005910
   00030 Pentose phosphate pathway
    KSO_005910
   00051 Fructose and mannose metabolism
    KSO_005910
   00052 Galactose metabolism
    KSO_005910
  09102 Energy metabolism
   00680 Methane metabolism
    KSO_005910
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    KSO_005910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bami01009]
    KSO_005910
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bami03019]
    KSO_005910
Enzymes [BR:bami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KSO_005910
Protein phosphatases and associated proteins [BR:bami01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KSO_005910
Messenger RNA biogenesis [BR:bami03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KSO_005910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AGF26679
LinkDB All DBs
Position
1131865..1132824
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcgggaaaatagaaaaactggagctgggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtatacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaattttaattcctgaagcggactacgatatggaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system