KEGG   Bacillus amyloliquefaciens IT-45: KSO_016030Help
Entry
KSO_016030        CDS       T02462                                 

Definition
(GenBank) protein YfmT
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00627  Aminobenzoate degradation
bami01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bami00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KSO_016030
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     KSO_016030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGF28693
LinkDB All DBs
Position
complement(3226153..3227610)
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFRKATPDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVAGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVEKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatgggagc
agccggaacgtattggaaaacagaaatccttatactcaaaaagtcatcacctcattccga
aaagcgacgcctgatgacgtggatgcggcatatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagccgtttctttcatt
gaagagcacgaagaagcgattatttacttaatcatggaggagcttggcggaacacggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgacggaaaagaaaacaggctgtac
agaatacctgccggagtcgcgggggtaatcagcccgtttaatttcccgtttttcctttcg
atgaaatctgttgcgccggcactcggcgcggggaacggcgtcgtgctgaagcctcatgaa
gaaacgccgatctgcggcggaacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaatgtcatcgtgacggatatcggggagatcggcgacagctttgttgag
catcccgtgccgcggataatctcatttacaggctcaaccggagtgggcagctatatcgga
cagcttgcggtcaaacactttaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggatgctgatcttgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcaaggccagatctgtatgtcggcgaaccgcgtgctcgttcacacatctgtttat
gacaaatttacagagctctacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcggtcctttaatcaatgagagacaggcggaaggcctgagacgg
tctgtcgaaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcctgtcattttaaaagatgtgaaacctgaaatgagcatcgcgaaggag
gagctgttcggaccggccgtctgcatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgtggagcgg
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgaccatt
aatgatgaaccgaacgttgcgttcggcggcgagaaacaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cgccaattcccatattaa

DBGET integrated database retrieval system