KEGG   Bacillus amyloliquefaciens IT-45: KSO_018835Help
Entry
KSO_018835        CDS       T02462                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bami  Bacillus amyloliquefaciens IT-45
Brite
KEGG Orthology (KO) [BR:bami00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bami03012]
    KSO_018835
   03029 Mitochondrial biogenesis [BR:bami03029]
    KSO_018835
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bami04147]
    KSO_018835
Translation factors [BR:bami03012]
 Eukaryotic Type
  Elongation factors
   KSO_018835
 Prokaryotic Type
   KSO_018835
Mitochondrial biogenesis [BR:bami03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KSO_018835
Exosome [BR:bami04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KSO_018835
  Exosomal proteins of breast cancer cells
   KSO_018835
  Exosomal proteins of colorectal cancer cells
   KSO_018835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AGF29247
LinkDB All DBs
Position
complement(3793853..3795043)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEYEEKILELMAAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIINLPEGVEMVMPGDNTE
MIVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatatcggtacaattggacac
gttgaccatggtaaaacaacattaactgctgctatctcaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgtgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgacactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gatggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgtagtattccttaacaaatgcgac
atggtagacgacgaagagcttcttgagcttgttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagttgttaaaggttctgctcttaaagctctt
gaaggcgatgctgagtacgaagaaaaaattcttgaacttatggctgcagttgatgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagaaaacagcaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgactacgctgaagctggagacaacatcggtgcactt
cttcgcggtgtagctcgtgaagatatccaacgtggacaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatcaatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgatcgttgaacttatctctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtacagttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system